mRNA_L-elsbetiae_contig9032.18061.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A6H5JKP4_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JKP4_9PHAE) HSP 1 Score: 101 bits (251), Expect = 1.090e-21 Identity = 47/74 (63.51%), Postives = 55/74 (74.32%), Query Frame = 1 Query: 1 GGGGVPADEDGEDSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 222 G GGV D+ EDSDGLDP HPDTCKIC VDILFLPC H CTCS CG+ Y GK CILCR +++ Q+VI++ Sbjct: 287 GAGGV--DDSDEDSDGLDPDHPDTCKICLDALVDILFLPCAHHCTCSRCGSAYEGKPCILCRRVVDKVQRVIKL 358
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: D7FX21_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FX21_ECTSI) HSP 1 Score: 99.0 bits (245), Expect = 3.310e-20 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 1 Query: 37 DSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 222 DSDGLDP HPDTCKIC VDILFLPC HQCTCS CG+ Y GK CILCR +++ Q+VI++ Sbjct: 955 DSDGLDPDHPDTCKICLDALVDILFLPCAHQCTCSRCGSAYEGKPCILCRRVVDKVQRVIKL 1016
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: A0A6H5J8V2_9PHAE (RING-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5J8V2_9PHAE) HSP 1 Score: 95.5 bits (236), Expect = 5.250e-19 Identity = 45/67 (67.16%), Postives = 50/67 (74.63%), Query Frame = 1 Query: 22 DEDGEDSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKVIRM 222 DED DSDGLDP HPDTCKIC V ILFLPC HQCTC CG+G+ GK CI+CR + RAQ VIR+ Sbjct: 1007 DED-XDSDGLDPDHPDTCKICMDALVGILFLPCAHQCTCVRCGSGFVGKPCIICRQKVTRAQPVIRL 1072
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Match: UPI00117AD610 (hypothetical protein n=1 Tax=Klebsiella pneumoniae TaxID=573 RepID=UPI00117AD610) HSP 1 Score: 50.8 bits (120), Expect = 1.800e-5 Identity = 21/47 (44.68%), Postives = 27/47 (57.45%), Query Frame = 1 Query: 73 CKICFCERVDILFLPCRHQCTCSGCGAGYRGKLCILCRAPIERAQKV 213 C IC +I+FLPC+H CTC+ CG G C +CR PI K+ Sbjct: 3 CIICLTSERNIVFLPCKHCCTCANCGLGL--DWCAVCREPIRELMKI 47 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig9032.18061.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig9032.18061.1 >prot_L-elsbetiae_contig9032.18061.1 ID=prot_L-elsbetiae_contig9032.18061.1|Name=mRNA_L-elsbetiae_contig9032.18061.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=89bp GGGGVPADEDGEDSDGLDPAHPDTCKICFCERVDILFLPCRHQCTCSGCGback to top mRNA from alignment at L-elsbetiae_contig9032:1678..3148- Legend: polypeptideCDSUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig9032.18061.1 ID=mRNA_L-elsbetiae_contig9032.18061.1|Name=mRNA_L-elsbetiae_contig9032.18061.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1471bp|location=Sequence derived from alignment at L-elsbetiae_contig9032:1678..3148- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig9032:1678..3148- >mRNA_L-elsbetiae_contig9032.18061.1 ID=mRNA_L-elsbetiae_contig9032.18061.1|Name=mRNA_L-elsbetiae_contig9032.18061.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=534bp|location=Sequence derived from alignment at L-elsbetiae_contig9032:1678..3148- (Laminarionema elsbetiae ELsaHSoW15)back to top |