mRNA_L-elsbetiae_contig7620.16543.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Match: A0A6H5K3H5_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5K3H5_9PHAE) HSP 1 Score: 99.0 bits (245), Expect = 3.430e-24 Identity = 46/86 (53.49%), Postives = 63/86 (73.26%), Query Frame = 1 Query: 10 QVRALLENVEVKGGVLDCCGATNDAVRTVLTANGLRVATNDLDSRLIADTHLDAATNTFVDAYSEDSRRPNWVVSSPSYKNAFGIL 267 +V ALL NV++ GGVLD CG+ +DA++ VL A+ L V+TND + RL ADTHLDA + F +S + +RP+W+V+SP Y NAF IL Sbjct: 14 KVDALLLNVKLAGGVLDACGSASDAIKVVLEAHSLNVSTNDFNPRLTADTHLDATSEEFTAMFSTEGQRPDWIVTSPPYGNAFSIL 99
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Match: A0A6H5KD58_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KD58_9PHAE) HSP 1 Score: 68.9 bits (167), Expect = 3.590e-12 Identity = 40/88 (45.45%), Postives = 53/88 (60.23%), Query Frame = 1 Query: 13 VRALLENVEVKGGVLDCCGATNDAVRTVLTANGLRVATNDLDSRLIADTHLDAATNTFVDAY--SEDSRRPNWVVSSPSYKNAFGILK 270 V ALL V + G +LD CG DAV T L V TND+ S ADT+LDA+ +F D + + +RP+WVV+SPSYK+A +K Sbjct: 103 VEALLGAVSITGCILDVCGGPTDAVATRLGPT-CEVLTNDVSSGRPADTNLDASLESFPDDFFAASSGKRPDWVVTSPSYKSALTFVK 189 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7620.16543.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7620.16543.1 >prot_L-elsbetiae_contig7620.16543.1 ID=prot_L-elsbetiae_contig7620.16543.1|Name=mRNA_L-elsbetiae_contig7620.16543.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=91bp MRFQVRALLENVEVKGGVLDCCGATNDAVRTVLTANGLRVATNDLDSRLIback to top mRNA from alignment at L-elsbetiae_contig7620:3531..3977- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7620.16543.1 ID=mRNA_L-elsbetiae_contig7620.16543.1|Name=mRNA_L-elsbetiae_contig7620.16543.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=447bp|location=Sequence derived from alignment at L-elsbetiae_contig7620:3531..3977- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7620:3531..3977- >mRNA_L-elsbetiae_contig7620.16543.1 ID=mRNA_L-elsbetiae_contig7620.16543.1|Name=mRNA_L-elsbetiae_contig7620.16543.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=546bp|location=Sequence derived from alignment at L-elsbetiae_contig7620:3531..3977- (Laminarionema elsbetiae ELsaHSoW15)back to top |