mRNA_L-elsbetiae_contig7587.16492.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: D8LKX2_ECTSI (Dynein light chain n=2 Tax=Ectocarpus TaxID=2879 RepID=D8LKX2_ECTSI) HSP 1 Score: 77.4 bits (189), Expect = 1.630e-16 Identity = 38/41 (92.68%), Postives = 40/41 (97.56%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKV+ Sbjct: 59 LRQVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVI 99
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A7R9Z009_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9Z009_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 7.300e-16 Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVDDNMSGSIDF EFLKV+ Sbjct: 35 LRQVLEAMGQKPTEEELFQMISEVDDNMSGSIDFGEFLKVI 75
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A835Z187_9STRA (EF hand-containing protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835Z187_9STRA) HSP 1 Score: 74.3 bits (181), Expect = 1.400e-15 Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVDDNMSGSIDF EFLKV+ Sbjct: 31 LRQVLEAMGQKPTEEELFQMISEVDDNMSGSIDFSEFLKVI 71
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A7S1CKF1_9STRA (Hypothetical protein n=1 Tax=Bicosoecida sp. CB-2014 TaxID=1486930 RepID=A0A7S1CKF1_9STRA) HSP 1 Score: 73.9 bits (180), Expect = 4.960e-15 Identity = 37/41 (90.24%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVDDNMSGSIDF EFLKV+ Sbjct: 75 LRQVLEAMGQKPTEEELFQMISEVDDNMSGSIDFGEFLKVI 115
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A812KW91_SYMMI (Calmodulin n=6 Tax=cellular organisms TaxID=131567 RepID=A0A812KW91_SYMMI) HSP 1 Score: 72.8 bits (177), Expect = 5.600e-15 Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVD+NMSGSIDF EFLKV+ Sbjct: 31 LRQVLEAMGQKPTEEELFQMISEVDENMSGSIDFAEFLKVI 71
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A6U4JW26_9STRA (Hypothetical protein n=1 Tax=Phaeomonas parva TaxID=124430 RepID=A0A6U4JW26_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 6.990e-15 Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVD+NMSGSIDF EFLKV+ Sbjct: 78 LRQVLEAMGQKPTEEELFQMISEVDENMSGSIDFAEFLKVI 118
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: K0TLU5_THAOC (EF-hand domain-containing protein n=1 Tax=Thalassiosira oceanica TaxID=159749 RepID=K0TLU5_THAOC) HSP 1 Score: 70.5 bits (171), Expect = 8.510e-15 Identity = 34/41 (82.93%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 +L+VLEAMGQ PTE+ELF+MISEVDDNMSGSIDF EFLKV+ Sbjct: 1 MLQVLEAMGQAPTEDELFEMISEVDDNMSGSIDFGEFLKVV 41
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A7S1XYK3_9STRA (Hypothetical protein n=2 Tax=Phaeomonas parva TaxID=124430 RepID=A0A7S1XYK3_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 1.460e-14 Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVD+NMSGSIDF EFLKV+ Sbjct: 78 LRQVLEAMGQKPTEEELFQMISEVDENMSGSIDFAEFLKVI 118
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A7S2GY36_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2GY36_9STRA) HSP 1 Score: 71.6 bits (174), Expect = 1.580e-14 Identity = 36/41 (87.80%), Postives = 38/41 (92.68%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVDDNMSGSIDF EFL V+ Sbjct: 31 LRQVLEAMGQKPTEEELFQMISEVDDNMSGSIDFAEFLLVI 71
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Match: A0A8J2SH02_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A8J2SH02_9STRA) HSP 1 Score: 72.8 bits (177), Expect = 1.770e-14 Identity = 36/41 (87.80%), Postives = 39/41 (95.12%), Query Frame = 1 Query: 1 LLKVLEAMGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVL 123 L +VLEAMGQKPTEEELFQMISEVD+NMSGSIDF EFLKV+ Sbjct: 89 LRQVLEAMGQKPTEEELFQMISEVDENMSGSIDFAEFLKVI 129 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig7587.16492.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig7587.16492.1 >prot_L-elsbetiae_contig7587.16492.1 ID=prot_L-elsbetiae_contig7587.16492.1|Name=mRNA_L-elsbetiae_contig7587.16492.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bp MGQKPTEEELFQMISEVDDNMSGSIDFPEFLKVLFLGSDAFLC*back to top mRNA from alignment at L-elsbetiae_contig7587:1347..1499- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig7587.16492.1 ID=mRNA_L-elsbetiae_contig7587.16492.1|Name=mRNA_L-elsbetiae_contig7587.16492.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=153bp|location=Sequence derived from alignment at L-elsbetiae_contig7587:1347..1499- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig7587:1347..1499- >mRNA_L-elsbetiae_contig7587.16492.1 ID=mRNA_L-elsbetiae_contig7587.16492.1|Name=mRNA_L-elsbetiae_contig7587.16492.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=264bp|location=Sequence derived from alignment at L-elsbetiae_contig7587:1347..1499- (Laminarionema elsbetiae ELsaHSoW15)back to top |