mRNA_L-elsbetiae_contig6809.15572.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6809.15572.1 vs. uniprot
Match: D8LJ48_ECTSI (Similar to doublecortin and CaM kinase-like 3 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LJ48_ECTSI) HSP 1 Score: 80.9 bits (198), Expect = 4.650e-16 Identity = 41/80 (51.25%), Postives = 55/80 (68.75%), Query Frame = 1 Query: 1 GIYFDSCSLGLMPALVDQTE--PGLAKERTEKLVKTLGNGPDMATAMRDIYLARHCNLDLSTSDSNGDLTRHGILGAGHY 234 G Y S G MP LV++ E P L + RT +LV+ N P M+TA+RDIY+AR C+LDLS +DSN DL+R ++GAG+Y Sbjct: 378 GDYSMPSSHGSMPELVNENEVEPHLTQTRTNRLVEIFRNAPLMSTAVRDIYIARRCDLDLSATDSNDDLSRERVIGAGYY 457
BLAST of mRNA_L-elsbetiae_contig6809.15572.1 vs. uniprot
Match: A0A6H5JND7_9PHAE (Protein kinase domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JND7_9PHAE) HSP 1 Score: 79.0 bits (193), Expect = 2.210e-15 Identity = 39/80 (48.75%), Postives = 52/80 (65.00%), Query Frame = 1 Query: 1 GIYFDSCSLGLMPAL--VDQTEPGLAKERTEKLVKTLGNGPDMATAMRDIYLARHCNLDLSTSDSNGDLTRHGILGAGHY 234 G + S G +P L V++ EP A R ++L + N P M TA+RDIY+A HC+LDLS SDSNGDLTR ++G G+Y Sbjct: 399 GDHIPPSSHGSIPELENVNEPEPHFAPTRMDRLFEIFSNAPRMFTAVRDIYVASHCDLDLSASDSNGDLTRERVIGTGYY 478
BLAST of mRNA_L-elsbetiae_contig6809.15572.1 vs. uniprot
Match: D7G381_ECTSI (N/a n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G381_ECTSI) HSP 1 Score: 78.2 bits (191), Expect = 4.110e-15 Identity = 34/63 (53.97%), Postives = 48/63 (76.19%), Query Frame = 1 Query: 46 VDQTEPGLAKERTEKLVKTLGNGPDMATAMRDIYLARHCNLDLSTSDSNGDLTRHGILGAGHY 234 V++ EP LA R ++L++ N P M+TA+RDIY+A HC+LDLS +DSNGDLTR ++G G+Y Sbjct: 398 VNEPEPHLAPTRMDRLIEIFSNVPLMSTAVRDIYIASHCDLDLSATDSNGDLTRERVIGTGYY 460
BLAST of mRNA_L-elsbetiae_contig6809.15572.1 vs. uniprot
Match: A0A6H5KAA7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KAA7_9PHAE) HSP 1 Score: 72.0 bits (175), Expect = 1.540e-14 Identity = 37/69 (53.62%), Postives = 49/69 (71.01%), Query Frame = 1 Query: 34 MPALVDQTE--PGLAKERTEKLVKTLGNGPDMATAMRDIYLARHCNLDLSTSDSNGDLTRHGILGAGHY 234 MP LV++ E P L + RT +L + N P M+TA+ DI ARHC+LDLS +DSNGDLTR ++GAG+Y Sbjct: 1 MPELVNEKELEPHLTRTRTNRLFEVFRNAPLMSTAVSDI--ARHCDLDLSATDSNGDLTRERVIGAGYY 67 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6809.15572.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6809.15572.1 >prot_L-elsbetiae_contig6809.15572.1 ID=prot_L-elsbetiae_contig6809.15572.1|Name=mRNA_L-elsbetiae_contig6809.15572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=78bp GIYFDSCSLGLMPALVDQTEPGLAKERTEKLVKTLGNGPDMATAMRDIYLback to top mRNA from alignment at L-elsbetiae_contig6809:5078..5313+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6809.15572.1 ID=mRNA_L-elsbetiae_contig6809.15572.1|Name=mRNA_L-elsbetiae_contig6809.15572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=236bp|location=Sequence derived from alignment at L-elsbetiae_contig6809:5078..5313+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6809:5078..5313+ >mRNA_L-elsbetiae_contig6809.15572.1 ID=mRNA_L-elsbetiae_contig6809.15572.1|Name=mRNA_L-elsbetiae_contig6809.15572.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=468bp|location=Sequence derived from alignment at L-elsbetiae_contig6809:5078..5313+ (Laminarionema elsbetiae ELsaHSoW15)back to top |