mRNA_L-elsbetiae_contig6786.15539.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6786.15539.1 vs. uniprot
Match: A0A6H5L556_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L556_9PHAE) HSP 1 Score: 54.3 bits (129), Expect = 8.960e-6 Identity = 35/54 (64.81%), Postives = 37/54 (68.52%), Query Frame = 1 Query: 262 MLKAHKRKTRRISGGGGVGRSVSPRPSLL----RGQQEPGRRASST-PSSPIVA 408 MLKAHKRKTRRIS GGG RSVSPRPS R PGRR S T P+SP+ A Sbjct: 1 MLKAHKRKTRRISSGGGSARSVSPRPSFGAEPGRRSAAPGRRKSKTAPTSPLDA 54 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6786.15539.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6786.15539.1 >prot_L-elsbetiae_contig6786.15539.1 ID=prot_L-elsbetiae_contig6786.15539.1|Name=mRNA_L-elsbetiae_contig6786.15539.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=54bp MLKAHKRKTRRISGGGGVGRSVSPRPSLLRGQQEPGRRASSTPSSPIVARback to top mRNA from alignment at L-elsbetiae_contig6786:6792..7214+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6786.15539.1 ID=mRNA_L-elsbetiae_contig6786.15539.1|Name=mRNA_L-elsbetiae_contig6786.15539.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=423bp|location=Sequence derived from alignment at L-elsbetiae_contig6786:6792..7214+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6786:6792..7214+ >mRNA_L-elsbetiae_contig6786.15539.1 ID=mRNA_L-elsbetiae_contig6786.15539.1|Name=mRNA_L-elsbetiae_contig6786.15539.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=324bp|location=Sequence derived from alignment at L-elsbetiae_contig6786:6792..7214+ (Laminarionema elsbetiae ELsaHSoW15)back to top |