mRNA_L-elsbetiae_contig6522.15213.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6522.15213.1 vs. uniprot
Match: A0A6H5L568_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L568_9PHAE) HSP 1 Score: 89.0 bits (219), Expect = 5.390e-18 Identity = 47/74 (63.51%), Postives = 51/74 (68.92%), Query Frame = -2 Query: 2 DEKATAAEMREDFADGVETGSARLRMTCGDPVFFGQLAELMQGLQRRSGGRKFLTHEEEMALGVKVQRYRRLIE 223 D K R+ G SARLRMTCGDPVFF LAELMQG+ R++GGRKFL HEEEM LG VQRYR LIE Sbjct: 367 DIKELTRTARKGDLTGGAMDSARLRMTCGDPVFFAHLAELMQGVHRQAGGRKFLNHEEEMELGETVQRYRALIE 440
BLAST of mRNA_L-elsbetiae_contig6522.15213.1 vs. uniprot
Match: D7G7N1_ECTSI (RNA polymerase sigma factor, cyanobacterial RpoD-like family n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G7N1_ECTSI) HSP 1 Score: 89.0 bits (219), Expect = 7.170e-18 Identity = 44/54 (81.48%), Postives = 46/54 (85.19%), Query Frame = -2 Query: 2 SARLRMTCGDPVFFGQLAELMQGLQRRSGGRKFLTHEEEMALGVKVQRYRRLIE 163 SARLRMTCGDPVFF LAELMQG+ R+SGGRKFL HEEEM LG VQRYR LIE Sbjct: 387 SARLRMTCGDPVFFAHLAELMQGVHRQSGGRKFLNHEEEMELGETVQRYRGLIE 440 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6522.15213.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6522.15213.1 >prot_L-elsbetiae_contig6522.15213.1 ID=prot_L-elsbetiae_contig6522.15213.1|Name=mRNA_L-elsbetiae_contig6522.15213.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=140bp MSRRYRCTFTPSAISSSWVRNFLPPDRRCRPCMSSASCPKNTGSPHVIRRback to top mRNA from alignment at L-elsbetiae_contig6522:1223..1647+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6522.15213.1 ID=mRNA_L-elsbetiae_contig6522.15213.1|Name=mRNA_L-elsbetiae_contig6522.15213.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=425bp|location=Sequence derived from alignment at L-elsbetiae_contig6522:1223..1647+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6522:1223..1647+ >mRNA_L-elsbetiae_contig6522.15213.1 ID=mRNA_L-elsbetiae_contig6522.15213.1|Name=mRNA_L-elsbetiae_contig6522.15213.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=840bp|location=Sequence derived from alignment at L-elsbetiae_contig6522:1223..1647+ (Laminarionema elsbetiae ELsaHSoW15)back to top |