mRNA_L-elsbetiae_contig6411.15090.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Match: D7G0B6_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G0B6_ECTSI) HSP 1 Score: 57.0 bits (136), Expect = 1.520e-7 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 104 MSFLDGLCDLPE-DIEISWRSFLHLEDVCSLTTLGAFASGLLALLTLAAVL 253 M FLDGLCD P+ + + SW F L++VCSLTTLGA +GL+ALL+ A+L Sbjct: 1 MGFLDGLCDSPDGEAKFSWHDFWRLDNVCSLTTLGAVVAGLVALLSFVAML 51
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Match: A0A6H5JJ25_9PHAE (ABC protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ25_9PHAE) HSP 1 Score: 56.6 bits (135), Expect = 2.080e-7 Identity = 29/51 (56.86%), Postives = 38/51 (74.51%), Query Frame = 2 Query: 104 MSFLDGLCDLPE-DIEISWRSFLHLEDVCSLTTLGAFASGLLALLTLAAVL 253 M FLDGLCD P+ + E SW F L++VCSLTTLGA +GL+AL++ A+L Sbjct: 1 MGFLDGLCDSPDGEAEFSWHDFWLLDNVCSLTTLGAVVAGLVALMSFVAML 51 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig6411.15090.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig6411.15090.1 >prot_L-elsbetiae_contig6411.15090.1 ID=prot_L-elsbetiae_contig6411.15090.1|Name=mRNA_L-elsbetiae_contig6411.15090.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=50bp MSFLDGLCDLPEDIEISWRSFLHLEDVCSLTTLGAFASGLLALLTLAAVLback to top mRNA from alignment at L-elsbetiae_contig6411:9580..10487+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig6411.15090.1 ID=mRNA_L-elsbetiae_contig6411.15090.1|Name=mRNA_L-elsbetiae_contig6411.15090.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=908bp|location=Sequence derived from alignment at L-elsbetiae_contig6411:9580..10487+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig6411:9580..10487+ >mRNA_L-elsbetiae_contig6411.15090.1 ID=mRNA_L-elsbetiae_contig6411.15090.1|Name=mRNA_L-elsbetiae_contig6411.15090.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=300bp|location=Sequence derived from alignment at L-elsbetiae_contig6411:9580..10487+ (Laminarionema elsbetiae ELsaHSoW15)back to top |