mRNA_L-elsbetiae_contig5752.14156.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5752.14156.1 vs. uniprot
Match: A0A7R9YY20_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9YY20_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 3.170e-7 Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 1 Query: 58 MCPGGVPGIPSVRGEVCCPTSCLNCGGRGCGTFPGGQGNCCIGGRNGILANSDF-CSQTMAAPC 246 C G+ G+ S EVCC +SC CGG GC FPGG NCC G +A+SD CS+ C Sbjct: 252 FCYNGIEGVSSSGVEVCCASSCGQCGGSGCWQFPGGSANCCTG----AIASSDIVCSEFTDVGC 311 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5752.14156.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig5752.14156.1 >prot_L-elsbetiae_contig5752.14156.1 ID=prot_L-elsbetiae_contig5752.14156.1|Name=mRNA_L-elsbetiae_contig5752.14156.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=107bp ESATPDPTAATPPPVAGGEMCPGGVPGIPSVRGEVCCPTSCLNCGGRGCGback to top mRNA from alignment at L-elsbetiae_contig5752:3864..4974- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig5752.14156.1 ID=mRNA_L-elsbetiae_contig5752.14156.1|Name=mRNA_L-elsbetiae_contig5752.14156.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=1111bp|location=Sequence derived from alignment at L-elsbetiae_contig5752:3864..4974- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig5752:3864..4974- >mRNA_L-elsbetiae_contig5752.14156.1 ID=mRNA_L-elsbetiae_contig5752.14156.1|Name=mRNA_L-elsbetiae_contig5752.14156.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=642bp|location=Sequence derived from alignment at L-elsbetiae_contig5752:3864..4974- (Laminarionema elsbetiae ELsaHSoW15)back to top |