prot_L-elsbetiae_contig5752.14156.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig5752.14156.1 vs. uniprot
Match: A0A7R9YY20_9STRA (Hypothetical protein (Fragment) n=1 Tax=Pseudictyota dubia TaxID=2749911 RepID=A0A7R9YY20_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 3.170e-7 Identity = 29/64 (45.31%), Postives = 35/64 (54.69%), Query Frame = 0 Query: 20 MCPGGVPGIPSVRGEVCCPTSCLNCGGRGCGTFPGGQGNCCIGGRNGILANSDF-CSQTMAAPC 82 C G+ G+ S EVCC +SC CGG GC FPGG NCC G +A+SD CS+ C Sbjct: 252 FCYNGIEGVSSSGVEVCCASSCGQCGGSGCWQFPGGSANCCTG----AIASSDIVCSEFTDVGC 311 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig5752.14156.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig5752.14156.1 ID=prot_L-elsbetiae_contig5752.14156.1|Name=mRNA_L-elsbetiae_contig5752.14156.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=107bpback to top |