mRNA_L-elsbetiae_contig20158.6063.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig20158.6063.1 vs. uniprot
Match: D7FMV8_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FMV8_ECTSI) HSP 1 Score: 91.7 bits (226), Expect = 1.750e-20 Identity = 42/43 (97.67%), Postives = 43/43 (100.00%), Query Frame = 1 Query: 1 MSGTGFVTFKCLSGRACAVSTLVSNRPEVFNLTPAPEPRDIVW 129 MSGTGFVTFKCLSGRACAVSTLV+NRPEVFNLTPAPEPRDIVW Sbjct: 1431 MSGTGFVTFKCLSGRACAVSTLVTNRPEVFNLTPAPEPRDIVW 1473
BLAST of mRNA_L-elsbetiae_contig20158.6063.1 vs. uniprot
Match: A0A6H5KIL5_9PHAE (ERD protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIL5_9PHAE) HSP 1 Score: 89.4 bits (220), Expect = 1.140e-19 Identity = 41/43 (95.35%), Postives = 42/43 (97.67%), Query Frame = 1 Query: 1 MSGTGFVTFKCLSGRACAVSTLVSNRPEVFNLTPAPEPRDIVW 129 MSGTGFVTFKCLSGRACAVSTLV+NRPEVFNL PAPEPRDIVW Sbjct: 1187 MSGTGFVTFKCLSGRACAVSTLVTNRPEVFNLKPAPEPRDIVW 1229
BLAST of mRNA_L-elsbetiae_contig20158.6063.1 vs. uniprot
Match: A0A7S0UJ14_9STRA (Hypothetical protein n=1 Tax=Pseudo-nitzschia delicatissima TaxID=44447 RepID=A0A7S0UJ14_9STRA) HSP 1 Score: 50.4 bits (119), Expect = 5.710e-6 Identity = 22/43 (51.16%), Postives = 32/43 (74.42%), Query Frame = 1 Query: 1 MSGTGFVTFKCLSGRACAVSTLVSNRPEVFNLTPAPEPRDIVW 129 MS TGFVTF L+ A ST ++++P+V ++T APEP+DI+W Sbjct: 475 MSSTGFVTFLDLTSLTTAASTPLTSKPQVLDVTVAPEPKDIIW 517 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig20158.6063.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig20158.6063.1 >prot_L-elsbetiae_contig20158.6063.1 ID=prot_L-elsbetiae_contig20158.6063.1|Name=mRNA_L-elsbetiae_contig20158.6063.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=44bp MSGTGFVTFKCLSGRACAVSTLVSNRPEVFNLTPAPEPRDIVW*back to top mRNA from alignment at L-elsbetiae_contig20158:760..891- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig20158.6063.1 ID=mRNA_L-elsbetiae_contig20158.6063.1|Name=mRNA_L-elsbetiae_contig20158.6063.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=132bp|location=Sequence derived from alignment at L-elsbetiae_contig20158:760..891- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig20158:760..891- >mRNA_L-elsbetiae_contig20158.6063.1 ID=mRNA_L-elsbetiae_contig20158.6063.1|Name=mRNA_L-elsbetiae_contig20158.6063.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=264bp|location=Sequence derived from alignment at L-elsbetiae_contig20158:760..891- (Laminarionema elsbetiae ELsaHSoW15)back to top |