mRNA_L-elsbetiae_contig19430.5769.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: A0A3B8NJ45_9FIRM (Uncharacterized protein n=1 Tax=Peptococcaceae bacterium TaxID=2052179 RepID=A0A3B8NJ45_9FIRM) HSP 1 Score: 51.2 bits (121), Expect = 3.050e-7 Identity = 23/32 (71.88%), Postives = 25/32 (78.12%), Query Frame = 1 Query: 58 RPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 153 +P T L +G RSEERRVGKECRSRWSPYH Sbjct: 42 QPVTEVLKEGEVFRSEERRVGKECRSRWSPYH 73
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015D7663E (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI0015D7663E) HSP 1 Score: 50.8 bits (120), Expect = 3.060e-7 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 1 Query: 82 QGSCSRSEERRVGKECRSRWSPYH 153 +G C RSEERRVGKECRSRWSPYH Sbjct: 35 EGVCIRSEERRVGKECRSRWSPYH 58
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI00116012D6 (hypothetical protein n=1 Tax=Enterococcus faecium TaxID=1352 RepID=UPI00116012D6) HSP 1 Score: 50.1 bits (118), Expect = 7.590e-7 Identity = 27/50 (54.00%), Postives = 32/50 (64.00%), Query Frame = 1 Query: 19 ISVECGTCYAPP-----PRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 153 I+V+ G + P P P AP+ +RSEERRVGKECRSRWSPYH Sbjct: 19 INVKTGVLRSIPNKINVPNP-PAPINAAKVARSEERRVGKECRSRWSPYH 67
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: A0A3C1WIN3_9BACT (Uncharacterized protein n=1 Tax=Fibrobacteres bacterium TaxID=2052160 RepID=A0A3C1WIN3_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 2.550e-6 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = 1 Query: 43 YAPPPRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 153 +AP P + G +RSEERRVGKECRSRWSPYH Sbjct: 88 FAPLITPELKHITLGGATRSEERRVGKECRSRWSPYH 124
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI001CC343BD (hypothetical protein n=1 Tax=Burkholderia vietnamiensis TaxID=60552 RepID=UPI001CC343BD) HSP 1 Score: 48.5 bits (114), Expect = 3.800e-6 Identity = 21/24 (87.50%), Postives = 21/24 (87.50%), Query Frame = -3 Query: 83 NDTATTEIYTLSLHDALPIWSKSP 154 NDTATTEIYTLSLHDALPIW P Sbjct: 17 NDTATTEIYTLSLHDALPIWRARP 40
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015D94BFF (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI0015D94BFF) HSP 1 Score: 47.4 bits (111), Expect = 7.200e-6 Identity = 22/35 (62.86%), Postives = 24/35 (68.57%), Query Frame = 1 Query: 61 PWTAPLL----QGSCSRSEERRVGKECRSRWSPYH 153 PW A + + RSEERRVGKECRSRWSPYH Sbjct: 24 PWIASSICSRDSSAAFRSEERRVGKECRSRWSPYH 58
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0009B75305 (BatD family protein n=1 Tax=Xanthomonas campestris pv. translucens TaxID=343 RepID=UPI0009B75305) HSP 1 Score: 50.4 bits (119), Expect = 8.110e-6 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 1 Query: 76 LLQGSCSRSEERRVGKECRSRWSPYH 153 +L G +RSEERRVGKECRSRWSPYH Sbjct: 379 VLPGRAARSEERRVGKECRSRWSPYH 404
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI001C5CAB24 (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI001C5CAB24) HSP 1 Score: 47.4 bits (111), Expect = 8.460e-6 Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = -3 Query: 95 NDTATTEIYTLSLHDALPIW 154 NDTATTEIYTLSLHDALPIW Sbjct: 48 NDTATTEIYTLSLHDALPIW 67
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI001E3ED01D (hypothetical protein n=1 Tax=Mycobacterium canettii TaxID=78331 RepID=UPI001E3ED01D) HSP 1 Score: 47.4 bits (111), Expect = 1.210e-5 Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = -3 Query: 95 NDTATTEIYTLSLHDALPIW 154 NDTATTEIYTLSLHDALPIW Sbjct: 45 NDTATTEIYTLSLHDALPIW 64
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: J2GI69_9SPHN (Uncharacterized protein (Fragment) n=1 Tax=Novosphingobium sp. AP12 TaxID=1144305 RepID=J2GI69_9SPHN) HSP 1 Score: 47.4 bits (111), Expect = 1.630e-5 Identity = 20/20 (100.00%), Postives = 20/20 (100.00%), Query Frame = -3 Query: 95 NDTATTEIYTLSLHDALPIW 154 NDTATTEIYTLSLHDALPIW Sbjct: 3 NDTATTEIYTLSLHDALPIW 22 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig19430.5769.1 >prot_L-elsbetiae_contig19430.5769.1 ID=prot_L-elsbetiae_contig19430.5769.1|Name=mRNA_L-elsbetiae_contig19430.5769.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bp SGAGQSISVECGTCYAPPPRPWTAPLLQGSCSRSEERRVGKECRSRWSPYback to top mRNA from alignment at L-elsbetiae_contig19430:2629..2784+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig19430.5769.1 ID=mRNA_L-elsbetiae_contig19430.5769.1|Name=mRNA_L-elsbetiae_contig19430.5769.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=156bp|location=Sequence derived from alignment at L-elsbetiae_contig19430:2629..2784+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig19430:2629..2784+ >mRNA_L-elsbetiae_contig19430.5769.1 ID=mRNA_L-elsbetiae_contig19430.5769.1|Name=mRNA_L-elsbetiae_contig19430.5769.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=312bp|location=Sequence derived from alignment at L-elsbetiae_contig19430:2629..2784+ (Laminarionema elsbetiae ELsaHSoW15)back to top |