prot_L-elsbetiae_contig19430.5769.1 (polypeptide) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: A0A3B8NJ45_9FIRM (Uncharacterized protein n=1 Tax=Peptococcaceae bacterium TaxID=2052179 RepID=A0A3B8NJ45_9FIRM) HSP 1 Score: 51.2 bits (121), Expect = 3.050e-7 Identity = 23/32 (71.88%), Postives = 25/32 (78.12%), Query Frame = 0 Query: 20 RPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 51 +P T L +G RSEERRVGKECRSRWSPYH Sbjct: 42 QPVTEVLKEGEVFRSEERRVGKECRSRWSPYH 73
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015D7663E (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI0015D7663E) HSP 1 Score: 50.8 bits (120), Expect = 3.060e-7 Identity = 21/24 (87.50%), Postives = 22/24 (91.67%), Query Frame = 0 Query: 28 QGSCSRSEERRVGKECRSRWSPYH 51 +G C RSEERRVGKECRSRWSPYH Sbjct: 35 EGVCIRSEERRVGKECRSRWSPYH 58
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI00116012D6 (hypothetical protein n=1 Tax=Enterococcus faecium TaxID=1352 RepID=UPI00116012D6) HSP 1 Score: 50.1 bits (118), Expect = 7.590e-7 Identity = 27/50 (54.00%), Postives = 32/50 (64.00%), Query Frame = 0 Query: 7 ISVECGTCYAPP-----PRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 51 I+V+ G + P P P AP+ +RSEERRVGKECRSRWSPYH Sbjct: 19 INVKTGVLRSIPNKINVPNP-PAPINAAKVARSEERRVGKECRSRWSPYH 67
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: A0A3C1WIN3_9BACT (Uncharacterized protein n=1 Tax=Fibrobacteres bacterium TaxID=2052160 RepID=A0A3C1WIN3_9BACT) HSP 1 Score: 50.1 bits (118), Expect = 2.550e-6 Identity = 23/37 (62.16%), Postives = 26/37 (70.27%), Query Frame = 0 Query: 15 YAPPPRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 51 +AP P + G +RSEERRVGKECRSRWSPYH Sbjct: 88 FAPLITPELKHITLGGATRSEERRVGKECRSRWSPYH 124
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015D94BFF (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI0015D94BFF) HSP 1 Score: 47.4 bits (111), Expect = 7.200e-6 Identity = 22/35 (62.86%), Postives = 24/35 (68.57%), Query Frame = 0 Query: 21 PWTAPLL----QGSCSRSEERRVGKECRSRWSPYH 51 PW A + + RSEERRVGKECRSRWSPYH Sbjct: 24 PWIASSICSRDSSAAFRSEERRVGKECRSRWSPYH 58
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0009B75305 (BatD family protein n=1 Tax=Xanthomonas campestris pv. translucens TaxID=343 RepID=UPI0009B75305) HSP 1 Score: 50.4 bits (119), Expect = 8.110e-6 Identity = 21/26 (80.77%), Postives = 23/26 (88.46%), Query Frame = 0 Query: 26 LLQGSCSRSEERRVGKECRSRWSPYH 51 +L G +RSEERRVGKECRSRWSPYH Sbjct: 379 VLPGRAARSEERRVGKECRSRWSPYH 404
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0019B38E9D (Uncharacterized protein n=2 Tax=Rubrivivax sp. A210 TaxID=2772301 RepID=UPI0019B38E9D) HSP 1 Score: 47.0 bits (110), Expect = 1.710e-5 Identity = 24/35 (68.57%), Postives = 25/35 (71.43%), Query Frame = 0 Query: 17 PPPRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 51 PP R PL +RSEERRVGKECRSRWSPYH Sbjct: 50 PPGRLGPRPLR---AARSEERRVGKECRSRWSPYH 81
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015B8F31D (hypothetical protein n=1 Tax=Enterococcus faecium TaxID=1352 RepID=UPI0015B8F31D) HSP 1 Score: 46.2 bits (108), Expect = 1.970e-5 Identity = 23/43 (53.49%), Postives = 27/43 (62.79%), Query Frame = 0 Query: 9 VECGTCYAPPPRPWTAPLLQGSCSRSEERRVGKECRSRWSPYH 51 + G P +++PL RSEERRVGKECRSRWSPYH Sbjct: 19 LSVGNSIRSPDAVFSSPLC-----RSEERRVGKECRSRWSPYH 56
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015D8F8C3 (hypothetical protein n=1 Tax=Staphylococcus haemolyticus TaxID=1283 RepID=UPI0015D8F8C3) HSP 1 Score: 46.2 bits (108), Expect = 2.060e-5 Identity = 20/26 (76.92%), Postives = 22/26 (84.62%), Query Frame = 0 Query: 26 LLQGSCSRSEERRVGKECRSRWSPYH 51 L++ RSEERRVGKECRSRWSPYH Sbjct: 33 LIEQLRIRSEERRVGKECRSRWSPYH 58
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Match: UPI0015B9221A (hypothetical protein n=1 Tax=Enterococcus faecium TaxID=1352 RepID=UPI0015B9221A) HSP 1 Score: 46.2 bits (108), Expect = 2.410e-5 Identity = 19/20 (95.00%), Postives = 20/20 (100.00%), Query Frame = 0 Query: 32 SRSEERRVGKECRSRWSPYH 51 +RSEERRVGKECRSRWSPYH Sbjct: 46 TRSEERRVGKECRSRWSPYH 65 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig19430.5769.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_L-elsbetiae_contig19430.5769.1 ID=prot_L-elsbetiae_contig19430.5769.1|Name=mRNA_L-elsbetiae_contig19430.5769.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=52bpback to top |