mRNA_L-elsbetiae_contig191.5627.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Match: A0A6H5JH11_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JH11_9PHAE) HSP 1 Score: 102 bits (253), Expect = 7.920e-25 Identity = 56/67 (83.58%), Postives = 58/67 (86.57%), Query Frame = -2 Query: 208 PFLDSVMDETVAFVSGLVLTLVEFIACLVIYRLYRDGFITSRVRLVLNAVAVSCMAGKMCLALVAIF 408 PFLDSVMD TVAF S L LTLVEFIACLVIYRLYR+ +TSRVRLVL VAVSCM GKMCLALVAIF Sbjct: 8 PFLDSVMDGTVAFASVLTLTLVEFIACLVIYRLYRNDDLTSRVRLVLTVVAVSCMVGKMCLALVAIF 74
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Match: A0A6H5JJ93_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JJ93_9PHAE) HSP 1 Score: 82.8 bits (203), Expect = 7.990e-16 Identity = 45/66 (68.18%), Postives = 50/66 (75.76%), Query Frame = -2 Query: 211 PFLDSVMDETVAFVSGLVLTLVEFIACLVIYRLYRDGFITSRVRLVLNAVAVSCMAGKMCLALVAI 408 PFLDS+MDET AF GLVLTLVEFI C+VIY +Y + + SR RLVL VA CM GKMCLA VAI Sbjct: 326 PFLDSIMDETTAFGIGLVLTLVEFIVCMVIYHVYMNDDLPSRARLVLVTVASCCMVGKMCLAWVAI 391
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Match: A0A6H5JL60_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JL60_9PHAE) HSP 1 Score: 79.3 bits (194), Expect = 1.150e-14 Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = -2 Query: 211 PFLDSVMDETVAFVSGLVLTLVEFIACLVIYRLYRDGFITSRVRLVLNAVAVSCMAGKMCLALVAI 408 PFLDS+MDET AF +GLVLTLVEFI C+VIY +Y+ + S RLVL VA CM GKMCLA V I Sbjct: 238 PFLDSIMDETTAFGTGLVLTLVEFILCVVIYHVYKHDDLPSGARLVLVTVASCCMVGKMCLAWVTI 303
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Match: A0A6H5KD04_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KD04_9PHAE) HSP 1 Score: 71.6 bits (174), Expect = 6.590e-12 Identity = 40/67 (59.70%), Postives = 48/67 (71.64%), Query Frame = -2 Query: 208 PFLDSVMDETVAFVSGLVLTLVEFIACLVIYRLYRDGFITSRVRLVLNAVAVSCMAGKMCLALVAIF 408 PFLDSVMD + AF GLV+TLVEFI C+VIY LY + + +RL L VA SCM GK+ LA +AIF Sbjct: 340 PFLDSVMDGSAAFGLGLVVTLVEFIVCVVIYHLYNHDDLPTNLRLGLYVVASSCMVGKLLLAALAIF 406
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Match: D8LFI4_ECTSI (Leucine Rich Repeat protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LFI4_ECTSI) HSP 1 Score: 67.4 bits (163), Expect = 2.130e-10 Identity = 34/66 (51.52%), Postives = 46/66 (69.70%), Query Frame = -2 Query: 211 PFLDSVMDETVAFVSGLVLTLVEFIACLVIYRLYRDGFITSRVRLVLNAVAVSCMAGKMCLALVAI 408 PF+DS++D T AF +GLVLTLVEF+AC+V Y L+ + R L +++ CM GKM LAL+AI Sbjct: 463 PFIDSILDGTRAFGAGLVLTLVEFVACIVTYHLFSSDHLPPHARWTLTIISICCMVGKMRLALLAI 528 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig191.5627.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 5
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig191.5627.1 >prot_L-elsbetiae_contig191.5627.1 ID=prot_L-elsbetiae_contig191.5627.1|Name=mRNA_L-elsbetiae_contig191.5627.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=115bp MWTRHVWQAVVASAPKVLFHTQPSPPSCRHLRTCYRFVRDYPTRIHERNIback to top mRNA from alignment at L-elsbetiae_contig191:34158..34566+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig191.5627.1 ID=mRNA_L-elsbetiae_contig191.5627.1|Name=mRNA_L-elsbetiae_contig191.5627.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=409bp|location=Sequence derived from alignment at L-elsbetiae_contig191:34158..34566+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig191:34158..34566+ >mRNA_L-elsbetiae_contig191.5627.1 ID=mRNA_L-elsbetiae_contig191.5627.1|Name=mRNA_L-elsbetiae_contig191.5627.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=690bp|location=Sequence derived from alignment at L-elsbetiae_contig191:34158..34566+ (Laminarionema elsbetiae ELsaHSoW15)back to top |