mRNA_L-elsbetiae_contig18505.5382.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig18505.5382.1 vs. uniprot
Match: D7G0M4_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G0M4_ECTSI) HSP 1 Score: 55.1 bits (131), Expect = 1.880e-5 Identity = 27/35 (77.14%), Postives = 29/35 (82.86%), Query Frame = 1 Query: 1 PNVVTYNAAIQACGSAGRWHEALGLLRAMLAEKIA 105 PNV T+NAA+QA GSAG W EAL LLR MLAEKIA Sbjct: 518 PNVATFNAAMQAAGSAGEWREALTLLRGMLAEKIA 552 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig18505.5382.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig18505.5382.1 >prot_L-elsbetiae_contig18505.5382.1 ID=prot_L-elsbetiae_contig18505.5382.1|Name=mRNA_L-elsbetiae_contig18505.5382.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=196bp PNVVTYNAAIQACGSAGRWHEALGLLRAMLAEKIAPNATSFTSAIAACGSback to top mRNA from alignment at L-elsbetiae_contig18505:580..1167- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig18505.5382.1 ID=mRNA_L-elsbetiae_contig18505.5382.1|Name=mRNA_L-elsbetiae_contig18505.5382.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=588bp|location=Sequence derived from alignment at L-elsbetiae_contig18505:580..1167- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig18505:580..1167- >mRNA_L-elsbetiae_contig18505.5382.1 ID=mRNA_L-elsbetiae_contig18505.5382.1|Name=mRNA_L-elsbetiae_contig18505.5382.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=1176bp|location=Sequence derived from alignment at L-elsbetiae_contig18505:580..1167- (Laminarionema elsbetiae ELsaHSoW15)back to top |