mRNA_L-elsbetiae_contig1843.5353.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: D7FRM9_ECTSI (40S ribosomal protein S28 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FRM9_ECTSI) HSP 1 Score: 59.3 bits (142), Expect = 4.550e-9 Identity = 28/28 (100.00%), Postives = 28/28 (100.00%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEFLDDPTRSIIRNVKGPVREGDIL Sbjct: 26 QVRVEFLDDPTRSIIRNVKGPVREGDIL 53
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A090L6S8_STRRB (40S ribosomal protein S28 n=2 Tax=Strongyloides TaxID=6247 RepID=A0A090L6S8_STRRB) HSP 1 Score: 57.0 bits (136), Expect = 3.460e-8 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEFLDDP RSIIRNVKGPVREGD+L Sbjct: 25 QVRVEFLDDPARSIIRNVKGPVREGDVL 52
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A0M0K694_9EUKA (40s ribosomal protein s28 n=1 Tax=Chrysochromulina tobinii TaxID=1460289 RepID=A0A0M0K694_9EUKA) HSP 1 Score: 56.6 bits (135), Expect = 4.880e-8 Identity = 25/27 (92.59%), Postives = 27/27 (100.00%), Query Frame = 2 Query: 377 VRVEFLDDPTRSIIRNVKGPVREGDIL 457 VRVEFLDDPTRSI+RNVKGP+REGDIL Sbjct: 26 VRVEFLDDPTRSIVRNVKGPIREGDIL 52
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: F0XVZ1_AURAN (Uncharacterized protein n=1 Tax=Aureococcus anophagefferens TaxID=44056 RepID=F0XVZ1_AURAN) HSP 1 Score: 56.6 bits (135), Expect = 5.000e-8 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEF+DDP RSIIRNVKGPVREGDIL Sbjct: 26 QVRVEFIDDPNRSIIRNVKGPVREGDIL 53
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A4D9CYK0_9STRA (Uncharacterized protein n=1 Tax=Nannochloropsis salina CCMP1776 TaxID=1027361 RepID=A0A4D9CYK0_9STRA) HSP 1 Score: 56.2 bits (134), Expect = 7.030e-8 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEFLDDPTRSI RNVKGPVREGD+L Sbjct: 26 QVRVEFLDDPTRSIRRNVKGPVREGDVL 53
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A1M2VYG2_TRAPU (40S ribosomal protein S28-A n=3 Tax=Polyporales TaxID=5303 RepID=A0A1M2VYG2_TRAPU) HSP 1 Score: 55.5 bits (132), Expect = 1.460e-7 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEF+DDPTRSIIRNVKGPVRE DIL Sbjct: 28 QVRVEFMDDPTRSIIRNVKGPVREKDIL 55
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A2N3N1P3_9PEZI (Uncharacterized protein n=1 Tax=Lomentospora prolificans TaxID=41688 RepID=A0A2N3N1P3_9PEZI) HSP 1 Score: 55.8 bits (133), Expect = 1.560e-7 Identity = 26/28 (92.86%), Postives = 27/28 (96.43%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QVRVEF+DDPTRSIIRNVKGPVRE DIL Sbjct: 28 QVRVEFMDDPTRSIIRNVKGPVREDDIL 55
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A3B3VFL0_9TELE (40S ribosomal protein S28 n=1 Tax=Poecilia latipinna TaxID=48699 RepID=A0A3B3VFL0_9TELE) HSP 1 Score: 55.1 bits (131), Expect = 1.700e-7 Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = 2 Query: 371 RQVRVEFLDDPTRSIIRNVKGPVREGDIL 457 RQVRVEF+DD RSIIRNVKGPVREGD+L Sbjct: 19 RQVRVEFMDDSNRSIIRNVKGPVREGDVL 47
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: A0A1J1IXW8_9DIPT (40S ribosomal protein S28 n=1 Tax=Clunio marinus TaxID=568069 RepID=A0A1J1IXW8_9DIPT) HSP 1 Score: 55.1 bits (131), Expect = 1.910e-7 Identity = 25/28 (89.29%), Postives = 28/28 (100.00%), Query Frame = 2 Query: 374 QVRVEFLDDPTRSIIRNVKGPVREGDIL 457 QV+VEFL+DPTR+IIRNVKGPVREGDIL Sbjct: 25 QVKVEFLNDPTRAIIRNVKGPVREGDIL 52
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Match: E4XNQ0_OIKDI (40S ribosomal protein S28 n=1 Tax=Oikopleura dioica TaxID=34765 RepID=E4XNQ0_OIKDI) HSP 1 Score: 55.1 bits (131), Expect = 2.060e-7 Identity = 30/54 (55.56%), Postives = 36/54 (66.67%), Query Frame = 2 Query: 296 ARLNLYNISDTLASR*TCTECYFFLRQVRVEFLDDPTRSIIRNVKGPVREGDIL 457 A + L ++D L + +C QV+VEFLDD RSIIRNVKGPVREGDIL Sbjct: 6 APVKLAKVTDVLGRTGSQGQC----TQVKVEFLDDTKRSIIRNVKGPVREGDIL 55 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig1843.5353.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig1843.5353.1 >prot_L-elsbetiae_contig1843.5353.1 ID=prot_L-elsbetiae_contig1843.5353.1|Name=mRNA_L-elsbetiae_contig1843.5353.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=102bp HRLFGYSLLHIYAVRFLVVVVDCEKCVLTRIHQNSDSATGRFVGHQVGSNback to top mRNA from alignment at L-elsbetiae_contig1843:20832..21288+ Legend: CDSpolypeptideUTR Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig1843.5353.1 ID=mRNA_L-elsbetiae_contig1843.5353.1|Name=mRNA_L-elsbetiae_contig1843.5353.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=457bp|location=Sequence derived from alignment at L-elsbetiae_contig1843:20832..21288+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig1843:20832..21288+ >mRNA_L-elsbetiae_contig1843.5353.1 ID=mRNA_L-elsbetiae_contig1843.5353.1|Name=mRNA_L-elsbetiae_contig1843.5353.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=612bp|location=Sequence derived from alignment at L-elsbetiae_contig1843:20832..21288+ (Laminarionema elsbetiae ELsaHSoW15)back to top |