mRNA_L-elsbetiae_contig17618.4976.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig17618.4976.1 vs. uniprot
Match: D7G4B2_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G4B2_ECTSI) HSP 1 Score: 89.0 bits (219), Expect = 1.460e-21 Identity = 41/45 (91.11%), Postives = 44/45 (97.78%), Query Frame = 1 Query: 1 SGVTPLHRAAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQ 135 SGVTPLHRAAEVNSCQVAQVLINA+ASVN RT+WGWYAPLHFAL+ Sbjct: 9 SGVTPLHRAAEVNSCQVAQVLINADASVNVRTSWGWYAPLHFALK 53
BLAST of mRNA_L-elsbetiae_contig17618.4976.1 vs. uniprot
Match: A0A7S4A937_9STRA (Hypothetical protein n=1 Tax=Pelagomonas calceolata TaxID=35677 RepID=A0A7S4A937_9STRA) HSP 1 Score: 61.2 bits (147), Expect = 1.720e-9 Identity = 35/96 (36.46%), Postives = 52/96 (54.17%), Query Frame = 1 Query: 1 SGVTPLHRAAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQNGHEQVAEILLQAGAKWT--------ILTKRLQTPYDLAVSRGLKIQALRI 264 SG+T LHRAA+V ++ + L+ A +A+T G PLH A+ GHE+ A LL+ GA W + R +TP AV +G ++ A R+ Sbjct: 34 SGMTLLHRAADVAQVEIIKYLMELGADASAKTFRGGDTPLHLAVSAGHEKAAMALLEGGAPWVPSKQKPKMAVNNRGETPMRTAVRKGYQLMAQRL 129
BLAST of mRNA_L-elsbetiae_contig17618.4976.1 vs. uniprot
Match: A0A8K1CK32_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1CK32_PYTOL) HSP 1 Score: 52.8 bits (125), Expect = 5.480e-6 Identity = 31/63 (49.21%), Postives = 41/63 (65.08%), Query Frame = 1 Query: 10 TPLHRAAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQNGHEQVAEILLQAGAKWTILT 198 T LH AAE +A++LINA A VNAR A GW APLH A +GH +V ++L+++ A LT Sbjct: 312 TALHLAAENGDEDIAELLINAGALVNARNAAGW-APLHIAALDGHLRVVQLLVRSRADIDSLT 373
BLAST of mRNA_L-elsbetiae_contig17618.4976.1 vs. uniprot
Match: UPI00033365C3 (2-5A-dependent ribonuclease n=1 Tax=Echinops telfairi TaxID=9371 RepID=UPI00033365C3) HSP 1 Score: 49.3 bits (116), Expect = 8.970e-5 Identity = 29/72 (40.28%), Postives = 39/72 (54.17%), Query Frame = 1 Query: 25 AAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQNGHEQVAEILLQAGAKWTILTKRLQTPYDLAVSRG 240 AA + AQ L+ A VN + WGW APLH A+QNG E + ++LL GA + + TP+ LA G Sbjct: 32 AARTGDVEKAQQLLERGADVNFQDEWGW-APLHNAVQNGKENLVDLLLLHGADPRLRKRNGATPFILAGIAG 102 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig17618.4976.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig17618.4976.1 >prot_L-elsbetiae_contig17618.4976.1 ID=prot_L-elsbetiae_contig17618.4976.1|Name=mRNA_L-elsbetiae_contig17618.4976.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=88bp SGVTPLHRAAEVNSCQVAQVLINAEASVNARTAWGWYAPLHFALQNGHEQback to top mRNA from alignment at L-elsbetiae_contig17618:2164..3144- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig17618.4976.1 ID=mRNA_L-elsbetiae_contig17618.4976.1|Name=mRNA_L-elsbetiae_contig17618.4976.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=981bp|location=Sequence derived from alignment at L-elsbetiae_contig17618:2164..3144- (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig17618:2164..3144- >mRNA_L-elsbetiae_contig17618.4976.1 ID=mRNA_L-elsbetiae_contig17618.4976.1|Name=mRNA_L-elsbetiae_contig17618.4976.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=528bp|location=Sequence derived from alignment at L-elsbetiae_contig17618:2164..3144- (Laminarionema elsbetiae ELsaHSoW15)back to top |