mRNA_L-elsbetiae_contig16883.4618.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig16883.4618.1 vs. uniprot
Match: D7G088_ECTSI (Uncharacterized protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7G088_ECTSI) HSP 1 Score: 54.3 bits (129), Expect = 2.320e-6 Identity = 23/31 (74.19%), Postives = 26/31 (83.87%), Query Frame = 1 Query: 4 GMWRRTHGFHWASLLLFSGVDKAAVADEVHR 96 GMWRR+HGFHW SLL FSGVDKA VA++ R Sbjct: 121 GMWRRSHGFHWESLLEFSGVDKADVAEQAAR 151
BLAST of mRNA_L-elsbetiae_contig16883.4618.1 vs. uniprot
Match: D7G089_ECTSI (Similar to 3-Dehydroquinate Synthase n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G089_ECTSI) HSP 1 Score: 52.0 bits (123), Expect = 1.770e-5 Identity = 25/29 (86.21%), Postives = 27/29 (93.10%), Query Frame = -2 Query: 231 GASMAMTDPKSQSRALSLVGSVDWIQVRC 317 GAS+ +TDPKSQSRALSLVGSVDWIQV C Sbjct: 157 GASLEVTDPKSQSRALSLVGSVDWIQVTC 185 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig16883.4618.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig16883.4618.1 >prot_L-elsbetiae_contig16883.4618.1 ID=prot_L-elsbetiae_contig16883.4618.1|Name=mRNA_L-elsbetiae_contig16883.4618.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=104bp MWRRTHGFHWASLLLFSGVDKAAVADEVHRYVLKFIGGVDVGMYGSTATWback to top mRNA from alignment at L-elsbetiae_contig16883:44..361+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig16883.4618.1 ID=mRNA_L-elsbetiae_contig16883.4618.1|Name=mRNA_L-elsbetiae_contig16883.4618.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=318bp|location=Sequence derived from alignment at L-elsbetiae_contig16883:44..361+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig16883:44..361+ >mRNA_L-elsbetiae_contig16883.4618.1 ID=mRNA_L-elsbetiae_contig16883.4618.1|Name=mRNA_L-elsbetiae_contig16883.4618.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=624bp|location=Sequence derived from alignment at L-elsbetiae_contig16883:44..361+ (Laminarionema elsbetiae ELsaHSoW15)back to top |