mRNA_L-elsbetiae_contig164.4347.1 (mRNA) Laminarionema elsbetiae ELsaHSoW15
Overview
Homology
BLAST of mRNA_L-elsbetiae_contig164.4347.1 vs. uniprot
Match: D7FR34_ECTSI (4HBT domain-containing protein n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FR34_ECTSI) HSP 1 Score: 58.2 bits (139), Expect = 1.040e-6 Identity = 24/30 (80.00%), Postives = 29/30 (96.67%), Query Frame = 3 Query: 3 PNVYDVDRILAKTPLLKNDNAFHDTLNSES 92 PNV+DVD+IL KTPLL+NDNAFHDTLN++S Sbjct: 90 PNVHDVDKILVKTPLLRNDNAFHDTLNNDS 119 The following BLAST results are available for this feature:
BLAST of mRNA_L-elsbetiae_contig164.4347.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_L-elsbetiae_contig164.4347.1 >prot_L-elsbetiae_contig164.4347.1 ID=prot_L-elsbetiae_contig164.4347.1|Name=mRNA_L-elsbetiae_contig164.4347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=polypeptide|length=126bp MRRRGCSRAHCMCWWKRARSRVNDVQKAMSAALHTATTALKKGARSVGRHback to top mRNA from alignment at L-elsbetiae_contig164:37957..38577+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_L-elsbetiae_contig164.4347.1 ID=mRNA_L-elsbetiae_contig164.4347.1|Name=mRNA_L-elsbetiae_contig164.4347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=mRNA|length=621bp|location=Sequence derived from alignment at L-elsbetiae_contig164:37957..38577+ (Laminarionema elsbetiae ELsaHSoW15)back to top Coding sequence (CDS) from alignment at L-elsbetiae_contig164:37957..38577+ >mRNA_L-elsbetiae_contig164.4347.1 ID=mRNA_L-elsbetiae_contig164.4347.1|Name=mRNA_L-elsbetiae_contig164.4347.1|organism=Laminarionema elsbetiae ELsaHSoW15|type=CDS|length=756bp|location=Sequence derived from alignment at L-elsbetiae_contig164:37957..38577+ (Laminarionema elsbetiae ELsaHSoW15)back to top |