prot_H-elongata_contig103651.303.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103651.303.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MRNGTEMIKTNLRLNVFGVKIDSYFHHTYYPSLSSMTWTLDYGKKSTLADDSVGFWHVARHPAKEKRDDWSRVYYSVELRIPSWVPGLVIGYLNSKAIREVNT102030405060708090100Expect = 1.11e-52 / Id = 77.67Expect = 2.71e-36 / Id = 59.22Expect = 9.99e-24 / Id = 46.81Expect = 1.55e-21 / Id = 48.78Expect = 2.12e-21 / Id = 49.44Expect = 8.50e-21 / Id = 42.86Expect = 8.87e-21 / Id = 44.12Expect = 5.90e-20 / Id = 42.55Expect = 1.43e-19 / Id = 41.67Expect = 6.23e-19 / Id = 50.62SequenceD8LT21_ECTSIA0A835Z7Q3_9STRAA0A4D9DD14_9STRAA0A7S2E2U9_9STRAA0A7S3FJR5_9EUKAA0A4D9CYH6_9STRAA0A7S0I6R2_9EUKAA0A7S2R0C2_9STRAA0A7S2A9L4_TRICVA0A6U4DG12_9STRA
Match NameE-valueIdentityDescription
D8LT21_ECTSI1.110e-5277.67Polyketide_cyc domain-containing protein n=2 Tax=E... [more]
A0A835Z7Q3_9STRA2.710e-3659.22Polyketide_cyc domain-containing protein n=1 Tax=T... [more]
A0A4D9DD14_9STRA9.990e-2446.81Polyketide_cyc domain-containing protein n=2 Tax=M... [more]
A0A7S2E2U9_9STRA1.550e-2148.78Hypothetical protein n=2 Tax=Helicotheca tamesis T... [more]
A0A7S3FJR5_9EUKA2.120e-2149.44Hypothetical protein n=1 Tax=Haptolina ericina Tax... [more]
A0A4D9CYH6_9STRA8.500e-2142.86Polyketide_cyc domain-containing protein n=2 Tax=M... [more]
A0A7S0I6R2_9EUKA8.870e-2144.12Hypothetical protein n=1 Tax=Phaeocystis antarctic... [more]
A0A7S2R0C2_9STRA5.900e-2042.55Hypothetical protein n=1 Tax=Eucampia antarctica T... [more]
A0A7S2A9L4_TRICV1.430e-1941.67Hypothetical protein (Fragment) n=1 Tax=Trieres ch... [more]
A0A6U4DG12_9STRA6.230e-1950.62Hypothetical protein n=1 Tax=Minutocellus polymorp... [more]

Pages

back to top