prot_H-elongata_contig103611.301.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103611.301.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MDVSVEDFDETVAVNTRAPLLVSQVCLEGMIKQKYSKIVNITSQSAVIAVKDHSVYCASKAAMDGLMNGLVCDLSQHNIQVNNIAPTVAWSDMGLKVWG102030405060708090Expect = 6.52e-49 / Id = 79.80Expect = 2.79e-26 / Id = 51.02Expect = 3.93e-26 / Id = 51.02Expect = 9.69e-26 / Id = 48.98Expect = 1.10e-25 / Id = 47.96Expect = 1.21e-24 / Id = 47.47Expect = 1.70e-24 / Id = 47.96Expect = 9.38e-24 / Id = 46.94Expect = 1.86e-23 / Id = 47.47Expect = 2.32e-23 / Id = 47.96SequenceD7FSQ4_ECTSIA0A832EU15_9RHOBUPI000D3E5D78A0A8I1LNS6_9RHOBA0A1G6A723_9HYPHA0A7W0MMG9_9RHOBA0A7C5IVK0_9HYPHV7ENK8_9RHOBUPI001F1AC034A0A7X3YXG8_9RHOB
Match NameE-valueIdentityDescription
D7FSQ4_ECTSI6.520e-4979.80Short-chain dehydrogenase/reductase SDR n=2 Tax=Ec... [more]
A0A832EU15_9RHOB2.790e-2651.02Glucose 1-dehydrogenase n=1 Tax=Rhodobacteraceae b... [more]
UPI000D3E5D783.930e-2651.02glucose 1-dehydrogenase n=1 Tax=Acuticoccus kandel... [more]
A0A8I1LNS6_9RHOB9.690e-2648.98SDR family oxidoreductase n=1 Tax=Rhodobacteraceae... [more]
A0A1G6A723_9HYPH1.100e-2547.96NAD(P)-dependent dehydrogenase, short-chain alcoho... [more]
A0A7W0MMG9_9RHOB1.210e-2447.47SDR family oxidoreductase n=1 Tax=Rhodobacteraceae... [more]
A0A7C5IVK0_9HYPH1.700e-2447.96Glucose 1-dehydrogenase n=1 Tax=Devosia sp. TaxID=... [more]
V7ENK8_9RHOB9.380e-2446.94Short-chain dehydrogenase n=5 Tax=Rhodobacteraceae... [more]
UPI001F1AC0341.860e-2347.47glucose 1-dehydrogenase n=1 Tax=Acuticoccus sp. M5... [more]
A0A7X3YXG8_9RHOB2.320e-2347.96SDR family oxidoreductase n=2 Tax=Rhodobacteraceae... [more]

Pages

back to top