prot_H-elongata_contig100511.52.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MCGGSKITPQEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV5101520253035404550556065Expect = 1.17e-16 / Id = 71.19Expect = 7.61e-16 / Id = 69.49Expect = 1.64e-12 / Id = 58.62Expect = 1.83e-12 / Id = 58.62Expect = 6.43e-12 / Id = 58.73Expect = 1.54e-8 / Id = 48.61Expect = 2.88e-8 / Id = 55.00Expect = 9.76e-8 / Id = 45.45Expect = 1.01e-7 / Id = 53.33Expect = 1.38e-7 / Id = 47.22SequenceD8LLR9_ECTSIA0A6H5JFB6_9PHAEA0A7S1YQL3_9STRAA0A7S4T8E3_9STRAA0A7S2BV78_9STRAD7MRI6_ARALLA0A565CQF7_9BRASUPI00063AFCFEA0A087GA83_ARAALP2C75_ARATH
Match NameE-valueIdentityDescription
D8LLR9_ECTSI1.170e-1671.19Uncharacterized protein n=1 Tax=Ectocarpus silicul... [more]
A0A6H5JFB6_9PHAE7.610e-1669.49Aurora kinase n=1 Tax=Ectocarpus sp. CCAP 1310/34 ... [more]
A0A7S1YQL3_9STRA1.640e-1258.62Hypothetical protein n=1 Tax=Ditylum brightwellii ... [more]
A0A7S4T8E3_9STRA1.830e-1258.62Hypothetical protein n=2 Tax=Ditylum brightwellii ... [more]
A0A7S2BV78_9STRA6.430e-1258.73Hypothetical protein n=1 Tax=Dictyocha speculum Ta... [more]
D7MRI6_ARALL1.540e-848.61Protein-serine/threonine phosphatase n=2 Tax=Arabi... [more]
A0A565CQF7_9BRAS2.880e-855.00Protein-serine/threonine phosphatase n=1 Tax=Arabi... [more]
UPI00063AFCFE9.760e-845.45probable protein phosphatase 2C 8 n=1 Tax=Gossypiu... [more]
A0A087GA83_ARAAL1.010e-753.33Protein-serine/threonine phosphatase n=1 Tax=Arabi... [more]
P2C75_ARATH1.380e-747.22Probable protein phosphatase 2C 75 n=8 Tax=Camelin... [more]

Pages

back to top