mRNA_H-elongata_contig100511.52.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: D8LLR9_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLR9_ECTSI) HSP 1 Score: 82.0 bits (201), Expect = 1.170e-16 Identity = 42/59 (71.19%), Postives = 49/59 (83.05%), Query Frame = 1 Query: 28 QEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVAS-RAGVAVLLTNDHRLNRPDERQRV 201 +EGDTSGST LVV+FDG +R +LVAN GDSRCVAS GVA L++DHRL+RPDER RV Sbjct: 1697 KEGDTSGSTALVVVFDGRSRSILVANVGDSRCVASCGGGVAARLSSDHRLSRPDERARV 1755
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A6H5JFB6_9PHAE (Aurora kinase n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JFB6_9PHAE) HSP 1 Score: 79.7 bits (195), Expect = 7.610e-16 Identity = 41/59 (69.49%), Postives = 48/59 (81.36%), Query Frame = 1 Query: 28 QEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVAS-RAGVAVLLTNDHRLNRPDERQRV 201 QE DTSG+T LVV+FDG +R +LVAN GDSRCVAS GVA L++DHRL+RPDER RV Sbjct: 1619 QEDDTSGATALVVVFDGRSRSILVANVGDSRCVASCGGGVATRLSSDHRLSRPDERARV 1677
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A7S1YQL3_9STRA (Hypothetical protein n=1 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S1YQL3_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 1.640e-12 Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 28 QEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 QE DTSGSTGL++L D L VAN GDSRCV SR G A++LT DHR+ ER+R+ Sbjct: 308 QESDTSGSTGLIILLDSLNGKLTVANVGDSRCVLSRGGAAMVLTTDHRVTNNTERRRI 365
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A7S4T8E3_9STRA (Hypothetical protein n=2 Tax=Ditylum brightwellii TaxID=49249 RepID=A0A7S4T8E3_9STRA) HSP 1 Score: 70.1 bits (170), Expect = 1.830e-12 Identity = 34/58 (58.62%), Postives = 41/58 (70.69%), Query Frame = 1 Query: 28 QEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 QE DTSGSTGL++L D L VAN GDSRCV SR G A++LT DHR+ ER+R+ Sbjct: 456 QESDTSGSTGLIILLDSLNGKLTVANVGDSRCVLSRGGAAMVLTTDHRVTNNTERRRI 513
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A7S2BV78_9STRA (Hypothetical protein n=1 Tax=Dictyocha speculum TaxID=35687 RepID=A0A7S2BV78_9STRA) HSP 1 Score: 68.6 bits (166), Expect = 6.430e-12 Identity = 37/63 (58.73%), Postives = 47/63 (74.60%), Query Frame = 1 Query: 16 KITPQEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLN-RPDERQRV 201 ++ Q D SGSTG++VLFDG L+VAN GDSRCV SR G A+ L+++HRL RPDER+RV Sbjct: 757 QMVAQSEDESGSTGIMVLFDG--THLIVANVGDSRCVLSRGGHAIELSSEHRLTTRPDERKRV 817
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: D7MRI6_ARALL (Protein-serine/threonine phosphatase n=2 Tax=Arabidopsis TaxID=3701 RepID=D7MRI6_ARALL) HSP 1 Score: 58.9 bits (141), Expect = 1.540e-8 Identity = 35/72 (48.61%), Postives = 47/72 (65.28%), Query Frame = 1 Query: 1 MCGGS----KITPQEGDTSGSTGLV-VLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 +CG S P+E SGST +V VL H ++VANTGDSR V R+G+A+ L+NDH+ +RPDER R+ Sbjct: 211 VCGTSVPLCNCDPREAAISGSTAVVAVLTQDH---IVVANTGDSRAVLCRSGLAIPLSNDHKPDRPDERARI 279
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A565CQF7_9BRAS (Protein-serine/threonine phosphatase n=1 Tax=Arabis nemorensis TaxID=586526 RepID=A0A565CQF7_9BRAS) HSP 1 Score: 58.2 bits (139), Expect = 2.880e-8 Identity = 33/60 (55.00%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 25 PQEGDTSGSTGLV-VLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 P+E SGST + VL H ++VANTGDSR V R+GVAV L+NDH+ +RPDER R+ Sbjct: 210 PREAAISGSTAVAAVLTQEH---IIVANTGDSRAVLCRSGVAVPLSNDHKPDRPDERARI 266
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: UPI00063AFCFE (probable protein phosphatase 2C 8 n=1 Tax=Gossypium raimondii TaxID=29730 RepID=UPI00063AFCFE) HSP 1 Score: 56.2 bits (134), Expect = 9.760e-8 Identity = 30/66 (45.45%), Postives = 43/66 (65.15%), Query Frame = 1 Query: 4 CGGSKITPQEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 CG + + +T GS +V+L +++VAN GDSR V RAG AV L++DH+L+RPDE +RV Sbjct: 60 CGTTAAVDEVMETMGSMAVVMLVS--REEVVVANCGDSRAVLCRAGTAVALSHDHKLDRPDEWERV 123
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: A0A087GA83_ARAAL (Protein-serine/threonine phosphatase n=1 Tax=Arabis alpina TaxID=50452 RepID=A0A087GA83_ARAAL) HSP 1 Score: 56.6 bits (135), Expect = 1.010e-7 Identity = 32/60 (53.33%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 25 PQEGDTSGSTGLV-VLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 P+E SGST + VL H ++VANTGDSR V R+GVA+ L+NDH+ +RPDER R+ Sbjct: 210 PREVAISGSTAVTAVLTQEH---IIVANTGDSRAVLCRSGVAIPLSNDHKPDRPDERARI 266
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Match: P2C75_ARATH (Probable protein phosphatase 2C 75 n=8 Tax=Camelineae TaxID=980083 RepID=P2C75_ARATH) HSP 1 Score: 56.2 bits (134), Expect = 1.380e-7 Identity = 34/72 (47.22%), Postives = 45/72 (62.50%), Query Frame = 1 Query: 1 MCGGS----KITPQEGDTSGSTGLV-VLFDGHARDLLVANTGDSRCVASRAGVAVLLTNDHRLNRPDERQRV 201 +CG S P+E SGST + VL H ++VANTGDSR V R G+A+ L+NDH+ +RPDER R+ Sbjct: 212 VCGTSVPLCNCDPREAAISGSTAVTAVLTHDH---IIVANTGDSRAVLCRNGMAIPLSNDHKPDRPDERARI 280 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100511.52.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig100511.52.1 >prot_H-elongata_contig100511.52.1 ID=prot_H-elongata_contig100511.52.1|Name=mRNA_H-elongata_contig100511.52.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=67bp MCGGSKITPQEGDTSGSTGLVVLFDGHARDLLVANTGDSRCVASRAGVAVback to top mRNA from alignment at H-elongata_contig100511:277..477- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig100511.52.1 ID=mRNA_H-elongata_contig100511.52.1|Name=mRNA_H-elongata_contig100511.52.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=201bp|location=Sequence derived from alignment at H-elongata_contig100511:277..477- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig100511:277..477- >mRNA_H-elongata_contig100511.52.1 ID=mRNA_H-elongata_contig100511.52.1|Name=mRNA_H-elongata_contig100511.52.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=402bp|location=Sequence derived from alignment at H-elongata_contig100511:277..477- (Himanthalia elongata Himel1 dioecious)back to top |