prot_H-elongata_contig100480.49.1 (polypeptide) Himanthalia elongata Himel1 dioecious

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100480.49.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
IDLFQQEPPECRVCRGEPEPDRRLYSPCLCSGSIMHTHEDCLLEWLKHSGKDSCELCGAMFRFTPVYDPDAPQFVPVYQVLR1020304050607080Expect = 2.57e-42 / Id = 85.71Expect = 6.51e-42 / Id = 85.71Expect = 4.07e-31 / Id = 74.65Expect = 1.49e-28 / Id = 64.38Expect = 5.16e-28 / Id = 62.03Expect = 7.09e-28 / Id = 65.28Expect = 9.46e-28 / Id = 65.28Expect = 2.44e-27 / Id = 69.12Expect = 3.33e-27 / Id = 61.25Expect = 3.33e-27 / Id = 58.75SequenceA0A6H5JWM1_9PHAED8LBR1_ECTSIA0A835YNH4_9STRAA0A7S2RW40_9STRAA0A225X148_9STRAD0RMI7_PHYITA0A2P4YC57_9STRAA0A5D6Y1M0_9STRAA0A0P1AST3_PLAHLA0A3M6VPX7_9STRA
Match NameE-valueIdentityDescription
A0A6H5JWM1_9PHAE2.570e-4285.71RING-CH-type domain-containing protein n=1 Tax=Ect... [more]
D8LBR1_ECTSI6.510e-4285.71RING-CH-type domain-containing protein n=1 Tax=Ect... [more]
A0A835YNH4_9STRA4.070e-3174.65RING-CH-type domain-containing protein n=1 Tax=Tri... [more]
A0A7S2RW40_9STRA1.490e-2864.38Hypothetical protein n=1 Tax=Rhizochromulina marin... [more]
A0A225X148_9STRA5.160e-2862.03E3 ubiquitin-protein ligase n=1 Tax=Phytophthora m... [more]
D0RMI7_PHYIT7.090e-2865.28RING-CH-type domain-containing protein n=1 Tax=Phy... [more]
A0A2P4YC57_9STRA9.460e-2865.28E3 ubiquitin-protein ligase (Fragment) n=1 Tax=Phy... [more]
A0A5D6Y1M0_9STRA2.440e-2769.12RING-CH-type domain-containing protein n=1 Tax=Pyt... [more]
A0A0P1AST3_PLAHL3.330e-2761.25E3 ubiquitin-protein ligase march6 (Membrane-assoc... [more]
A0A3M6VPX7_9STRA3.330e-2758.75RING-CH-type domain-containing protein n=2 Tax=Per... [more]

Pages

back to top