mRNA_H-elongata_contig103695.308.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig103695.308.1 vs. uniprot
Match: A0A6D2HB54_9BRAS (CCHC-type domain-containing protein n=1 Tax=Microthlaspi erraticum TaxID=1685480 RepID=A0A6D2HB54_9BRAS) HSP 1 Score: 58.9 bits (141), Expect = 4.780e-7 Identity = 30/82 (36.59%), Postives = 51/82 (62.20%), Query Frame = 1 Query: 55 IGAKSLSGAWAILNSMVDDEDSEIAKEQAKNKFEELRMESGQTIREYIAKVKSMANQIRYYGIEKSDHEISRRILNGFSPAY 300 + A S AW +L +++ S++ + + +FEELRME G+T +YI +VK + Q+R I KSD+E+++++LN S Y Sbjct: 85 LSASSAKEAWDLLRKG-NEQKSKLGR--LEKRFEELRMEEGETFNDYIDRVKEIVEQLRRLNISKSDYEVTKKVLNSLSAPY 163 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig103695.308.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig103695.308.1 >prot_H-elongata_contig103695.308.1 ID=prot_H-elongata_contig103695.308.1|Name=mRNA_H-elongata_contig103695.308.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=176bp MKCPDESPGKDKTIAEVVIGAKSLSGAWAILNSMVDDEDSEIAKEQAKNKback to top mRNA from alignment at H-elongata_contig103695:157..684- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig103695.308.1 ID=mRNA_H-elongata_contig103695.308.1|Name=mRNA_H-elongata_contig103695.308.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=528bp|location=Sequence derived from alignment at H-elongata_contig103695:157..684- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig103695:157..684- >mRNA_H-elongata_contig103695.308.1 ID=mRNA_H-elongata_contig103695.308.1|Name=mRNA_H-elongata_contig103695.308.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=1056bp|location=Sequence derived from alignment at H-elongata_contig103695:157..684- (Himanthalia elongata Himel1 dioecious)back to top |