mRNA_H-elongata_contig102942.251.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A836CLA6_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A836CLA6_9STRA) HSP 1 Score: 84.7 bits (208), Expect = 7.070e-17 Identity = 43/89 (48.31%), Postives = 59/89 (66.29%), Query Frame = 1 Query: 40 KLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHR--------AAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAAEWHYLAVDQG 282 + AA++GH +A+WL+GR YYEG+G ++ EA WF R AA +GSA+GQ YL G+++EYG GVPK+ +RA WH A QG Sbjct: 133 RSAAAKGHAEALWLVGRCYYEGRGA-AQNYTEAAAWFDRLWEECTAGAAGRGSAKGQFYL-GVLNEYGYGVPKDTKRAIAWHLRAARQG 219
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: D8LE06_ECTSI (Sel1 domain protein repeat-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LE06_ECTSI) HSP 1 Score: 70.9 bits (172), Expect = 1.140e-12 Identity = 35/51 (68.63%), Postives = 40/51 (78.43%), Query Frame = 1 Query: 91 MYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQR 243 M+ EGKGV VDF EAN+WFHRAAAKG+A GQH+L GI EYG GV K+ R Sbjct: 1 MHCEGKGVAKVDFDEANKWFHRAAAKGNARGQHHL-GIAHEYGSGVTKDLR 50
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A839IR32_9GAMM (Sel1 repeat family protein n=1 Tax=Oceanospirillum sp. D5 TaxID=2760088 RepID=A0A839IR32_9GAMM) HSP 1 Score: 59.3 bits (142), Expect = 2.490e-8 Identity = 36/90 (40.00%), Postives = 48/90 (53.33%), Query Frame = 1 Query: 16 HRAATAWFKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLG-VPKNQRRAAEWHYLAVDQG 282 HR AWFK AASEGH+ A + G + Y +G VD G+ + AA +G A+ Q+ +A I E G G + KN A W A +QG Sbjct: 32 HRWIMAWFKQAASEGHLKAQSMYGHLLYF-RGASPVDKGQGANYLLDAAKRGDAKAQYQIACIY-ETGFGHLQKNYENAVRWFVKAAEQG 119
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A1U9NQJ7_9BACT (Putative beta-lactamase HcpC n=1 Tax=Anaerohalosphaera lusitana TaxID=1936003 RepID=A0A1U9NQJ7_9BACT) HSP 1 Score: 58.5 bits (140), Expect = 2.210e-7 Identity = 32/85 (37.65%), Postives = 48/85 (56.47%), Query Frame = 1 Query: 37 FKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAAEWHYLAVDQGLAD 291 + +A G++DAM+ +G + EGKG D+ A WF +AA G A LA + E G+G+ KN+ +AAEW+ A Q + D Sbjct: 45 YSRSARMGNVDAMYQMGLFHLEGKGGVDRDYAVAMGWFEKAARTGHALAMGKLADMYAE-GMGIFKNELKAAEWYQKASQQAIRD 128
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A1H3MYG3_9BURK (Uncharacterized protein n=1 Tax=Collimonas sp. OK242 TaxID=1798195 RepID=A0A1H3MYG3_9BURK) HSP 1 Score: 55.5 bits (132), Expect = 1.640e-6 Identity = 30/77 (38.96%), Postives = 51/77 (66.23%), Query Frame = 1 Query: 25 ATAWFKLAASEGHIDAMWLLGRMYYEGKGVGV-VDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAA 252 A AW + AA+ ++A + LG+ +Y+G G+G +D+G+A W+ RAA G+A+ LA + +YG GVP++ +R+A Sbjct: 82 AGAWLQNAAAANDVEAQFQLGQAFYQG-GLGFQLDYGQAWNWYERAAVAGNAKAGFMLARMA-KYGEGVPRDLKRSA 156
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A831PJR1_9DELT (Sel1 repeat family protein n=1 Tax=Geoalkalibacter subterraneus TaxID=483547 RepID=A0A831PJR1_9DELT) HSP 1 Score: 54.7 bits (130), Expect = 2.750e-6 Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 1 Query: 34 WFKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAAEWHYLAVDQGLADSNNHLGLMKAHGKG 333 W ++AA G+ DA++ LGR+Y +G+GV VD ++ E+F AA K H + + E P A +W A D G AD+ N L ++ +G Sbjct: 3 WLQMAADAGYGDALYALGRIYEQGRGV-EVDREQSFEFFSAAARKNHPGAMHQMGRLALEQDA--PDAAVHALDWFRRAADSGEADALNDLAVLFLRQQG 99
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A1I3CEV3_9BURK (Uncharacterized protein n=3 Tax=Collimonas TaxID=202907 RepID=A0A1I3CEV3_9BURK) HSP 1 Score: 53.9 bits (128), Expect = 5.890e-6 Identity = 28/77 (36.36%), Postives = 48/77 (62.34%), Query Frame = 1 Query: 25 ATAWFKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAAE 255 A AW + AA+ +A + LG+ +Y+G+ VD+G+A W+ RAA G+A+ LA + +YG GVP++ + +A+ Sbjct: 82 AGAWMQNAAAANEPEAQFQLGQAFYQGRLGFQVDYGQAWNWYERAATSGNAKASFMLARMA-KYGEGVPQDLKLSAK 157
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Match: A0A1Y1W8F9_9FUNG (HCP-like protein n=1 Tax=Linderina pennispora TaxID=61395 RepID=A0A1Y1W8F9_9FUNG) HSP 1 Score: 51.2 bits (121), Expect = 7.150e-5 Identity = 35/119 (29.41%), Postives = 55/119 (46.22%), Query Frame = 1 Query: 25 ATAWFKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFHRAAAKGSAEGQHYLAGIVDEYGLGVPKNQRRAAEWHYLAVDQGLADSNNHLGLMKAHGKGFSQDLTGAARHFQKVI 381 A WF+ AA G + +++ G + G FGEA ++F RAAA G+ E Q Y G+ G G KN A E+ +A + + +L + GK ++D A R + + Sbjct: 228 ARGWFEEAARLGSPEGLFMAGTVL-----AGEEKFGEALDYFERAAALGNVEAQ-YNVGLYYLQGTGCEKNPELAVEYWTMAAAERFPVAMLNLAKLLMEGKEVARDRRRARRLLEAAV 340 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102942.251.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 8 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following polypeptide feature(s) derives from this mRNA:
The following CDS feature(s) are a part of this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102942.251.1 >prot_H-elongata_contig102942.251.1 ID=prot_H-elongata_contig102942.251.1|Name=mRNA_H-elongata_contig102942.251.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=132bp GGSRDHRAATAWFKLAASEGHIDAMWLLGRMYYEGKGVGVVDFGEANEWFback to top mRNA from alignment at H-elongata_contig102942:300..2286- Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102942.251.1 ID=mRNA_H-elongata_contig102942.251.1|Name=mRNA_H-elongata_contig102942.251.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=1987bp|location=Sequence derived from alignment at H-elongata_contig102942:300..2286- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102942:300..2286- >mRNA_H-elongata_contig102942.251.1 ID=mRNA_H-elongata_contig102942.251.1|Name=mRNA_H-elongata_contig102942.251.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=792bp|location=Sequence derived from alignment at H-elongata_contig102942:300..2286- (Himanthalia elongata Himel1 dioecious)back to top |