mRNA_H-elongata_contig102774.240.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102774.240.1 vs. uniprot
Match: D7FNA6_ECTSI (Similar to titin isoform N2-B n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FNA6_ECTSI) HSP 1 Score: 63.5 bits (153), Expect = 3.960e-10 Identity = 32/51 (62.75%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 52 TLDKANVRHCIPQAPRLVDASAAGPNALIVAWSGVPSPTSGCTVSSYRVEV 204 T ++ V P AP +VDASAAGPN L+V WSGVPS SG TVSSYR+EV Sbjct: 8303 TTPRSMVPRAAPGAPGMVDASAAGPNDLMVTWSGVPSSISGSTVSSYRIEV 8353 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102774.240.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102774.240.1 >prot_H-elongata_contig102774.240.1 ID=prot_H-elongata_contig102774.240.1|Name=mRNA_H-elongata_contig102774.240.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=64bp MCMLLVSDAYDLRTLDKANVRHCIPQAPRLVDASAAGPNALIVAWSGVPSback to top mRNA from alignment at H-elongata_contig102774:203..406- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102774.240.1 ID=mRNA_H-elongata_contig102774.240.1|Name=mRNA_H-elongata_contig102774.240.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=204bp|location=Sequence derived from alignment at H-elongata_contig102774:203..406- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102774:203..406- >mRNA_H-elongata_contig102774.240.1 ID=mRNA_H-elongata_contig102774.240.1|Name=mRNA_H-elongata_contig102774.240.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=384bp|location=Sequence derived from alignment at H-elongata_contig102774:203..406- (Himanthalia elongata Himel1 dioecious)back to top |