mRNA_H-elongata_contig102365.206.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A6H5KIL8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIL8_9PHAE) HSP 1 Score: 87.4 bits (215), Expect = 8.080e-19 Identity = 42/51 (82.35%), Postives = 49/51 (96.08%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 RI EL+QD+VSVLLLPLYFAVSGLKTDLTLLD+ATSWGIC +TI+AAC+G+ Sbjct: 161 RIVELVQDVVSVLLLPLYFAVSGLKTDLTLLDSATSWGICALTISAACLGK 211
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: D8LLK5_ECTSI (K+ homeostasis protein Kha1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLK5_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 5.240e-18 Identity = 41/51 (80.39%), Postives = 48/51 (94.12%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 RI EL+QD+VSVLLLPLYFAVSGLKTDLTLLD+AT WGIC +TI+AAC+G+ Sbjct: 306 RIVELVQDVVSVLLLPLYFAVSGLKTDLTLLDSATLWGICALTISAACLGK 356
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A426ZWW0_ENSVE (Na_H_Exchanger domain-containing protein n=1 Tax=Ensete ventricosum TaxID=4639 RepID=A0A426ZWW0_ENSVE) HSP 1 Score: 63.5 bits (153), Expect = 2.020e-10 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 R+ E I+D VSVLLLPLYFA SGLKT++ + +ATSWGI + I ACVG+ Sbjct: 318 RLTERIEDFVSVLLLPLYFASSGLKTNVASIKDATSWGILALVICTACVGK 368
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A444G2R7_ENSVE (Na_H_Exchanger domain-containing protein n=3 Tax=Musaceae TaxID=4637 RepID=A0A444G2R7_ENSVE) HSP 1 Score: 63.5 bits (153), Expect = 2.040e-10 Identity = 31/51 (60.78%), Postives = 39/51 (76.47%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 R+ E I+D VSVLLLPLYFA SGLKT++ + +ATSWGI + I ACVG+ Sbjct: 318 RLTERIEDFVSVLLLPLYFASSGLKTNVASIKDATSWGILALVICTACVGK 368
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A0L0RVN0_ALLM3 (Na_H_Exchanger domain-containing protein n=1 Tax=Allomyces macrogynus (strain ATCC 38327) TaxID=578462 RepID=A0A0L0RVN0_ALLM3) HSP 1 Score: 62.0 bits (149), Expect = 7.130e-10 Identity = 27/50 (54.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 4 IAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 + E ++D+V+++LLPLYFA+SGLKT L LLD AT+WG+ V+ + AC G+ Sbjct: 514 LTEKVEDLVTIVLLPLYFALSGLKTRLGLLDTATTWGLLVLVLVTACAGK 563
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A0L0RUR2_ALLM3 (Na_H_Exchanger domain-containing protein n=1 Tax=Allomyces macrogynus (strain ATCC 38327) TaxID=578462 RepID=A0A0L0RUR2_ALLM3) HSP 1 Score: 62.0 bits (149), Expect = 7.130e-10 Identity = 27/50 (54.00%), Postives = 40/50 (80.00%), Query Frame = 1 Query: 4 IAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 + E ++D+V+++LLPLYFA+SGLKT L LLD AT+WG+ V+ + AC G+ Sbjct: 324 LTEKVEDLVTIVLLPLYFALSGLKTRLGLLDTATTWGLLVLVLVTACAGK 373
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: UPI001CC34388 (cation/H(+) antiporter 20-like n=1 Tax=Telopea speciosissima TaxID=54955 RepID=UPI001CC34388) HSP 1 Score: 61.2 bits (147), Expect = 1.330e-9 Identity = 30/51 (58.82%), Postives = 38/51 (74.51%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 R+ E I+D VS LLLPLYFA SGLKTD+T + A +WG+ V+ IA AC G+ Sbjct: 311 RLIERIEDFVSGLLLPLYFASSGLKTDVTKMHGAEAWGLLVLVIATACAGK 361
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A1J3DKG9_NOCCA (Cation/H(+) antiporter 19 (Fragment) n=1 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3DKG9_NOCCA) HSP 1 Score: 57.8 bits (138), Expect = 1.680e-9 Identity = 28/50 (56.00%), Postives = 36/50 (72.00%), Query Frame = 1 Query: 4 IAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 + E I+D+VS LLLPLYFA SGLKTD+T + A SWG+ V+ I C G+ Sbjct: 47 LTEKIEDLVSGLLLPLYFASSGLKTDVTTIKGAQSWGLLVLVILTTCFGK 96
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: UPI00053C4778 (cation/H(+) antiporter 20-like n=1 Tax=Tarenaya hassleriana TaxID=28532 RepID=UPI00053C4778) HSP 1 Score: 60.8 bits (146), Expect = 1.820e-9 Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 R+ E I+D VSVLLLPLYFA SGLKTD+ + A +WGI + IA AC G+ Sbjct: 325 RLIERIEDFVSVLLLPLYFASSGLKTDVAKIRGAEAWGILALVIATACAGK 375
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A4Y7L255_PAPSO (Na_H_Exchanger domain-containing protein n=2 Tax=Papaver somniferum TaxID=3469 RepID=A0A4Y7L255_PAPSO) HSP 1 Score: 60.8 bits (146), Expect = 1.820e-9 Identity = 30/51 (58.82%), Postives = 37/51 (72.55%), Query Frame = 1 Query: 1 RIAELIQDMVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 153 R+ E I+D VS LLLPLYFA SGLKTD+T + A SWG+ + IA AC G+ Sbjct: 310 RLIERIEDFVSGLLLPLYFASSGLKTDVTKIRGAASWGLLALVIAVACAGK 360 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig102365.206.1 >prot_H-elongata_contig102365.206.1 ID=prot_H-elongata_contig102365.206.1|Name=mRNA_H-elongata_contig102365.206.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=45bp MVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGES*back to top mRNA from alignment at H-elongata_contig102365:1360..1518- Legend: UTRCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig102365.206.1 ID=mRNA_H-elongata_contig102365.206.1|Name=mRNA_H-elongata_contig102365.206.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=159bp|location=Sequence derived from alignment at H-elongata_contig102365:1360..1518- (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig102365:1360..1518- >mRNA_H-elongata_contig102365.206.1 ID=mRNA_H-elongata_contig102365.206.1|Name=mRNA_H-elongata_contig102365.206.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=270bp|location=Sequence derived from alignment at H-elongata_contig102365:1360..1518- (Himanthalia elongata Himel1 dioecious)back to top |