prot_H-elongata_contig102365.206.1 (polypeptide) Himanthalia elongata Himel1 dioecious
You are viewing a polypeptide, more information available on the corresponding mRNA page
Overview
Homology
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A6H5KIL8_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KIL8_9PHAE) HSP 1 Score: 75.5 bits (184), Expect = 8.930e-15 Identity = 36/42 (85.71%), Postives = 41/42 (97.62%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VSVLLLPLYFAVSGLKTDLTLLD+ATSWGIC +TI+AAC+G+ Sbjct: 170 VSVLLLPLYFAVSGLKTDLTLLDSATSWGICALTISAACLGK 211
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: D8LLK5_ECTSI (K+ homeostasis protein Kha1 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LLK5_ECTSI) HSP 1 Score: 73.2 bits (178), Expect = 5.810e-14 Identity = 35/42 (83.33%), Postives = 40/42 (95.24%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VSVLLLPLYFAVSGLKTDLTLLD+AT WGIC +TI+AAC+G+ Sbjct: 315 VSVLLLPLYFAVSGLKTDLTLLDSATLWGICALTISAACLGK 356
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A0L0RUR2_ALLM3 (Na_H_Exchanger domain-containing protein n=1 Tax=Allomyces macrogynus (strain ATCC 38327) TaxID=578462 RepID=A0A0L0RUR2_ALLM3) HSP 1 Score: 56.6 bits (135), Expect = 3.980e-8 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 1 MVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 +V+++LLPLYFA+SGLKT L LLD AT+WG+ V+ + AC G+ Sbjct: 331 LVTIVLLPLYFALSGLKTRLGLLDTATTWGLLVLVLVTACAGK 373
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A0L0RVN0_ALLM3 (Na_H_Exchanger domain-containing protein n=1 Tax=Allomyces macrogynus (strain ATCC 38327) TaxID=578462 RepID=A0A0L0RVN0_ALLM3) HSP 1 Score: 56.6 bits (135), Expect = 3.980e-8 Identity = 25/43 (58.14%), Postives = 35/43 (81.40%), Query Frame = 0 Query: 1 MVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 +V+++LLPLYFA+SGLKT L LLD AT+WG+ V+ + AC G+ Sbjct: 521 LVTIVLLPLYFALSGLKTRLGLLDTATTWGLLVLVLVTACAGK 563
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A426ZWW0_ENSVE (Na_H_Exchanger domain-containing protein n=1 Tax=Ensete ventricosum TaxID=4639 RepID=A0A426ZWW0_ENSVE) HSP 1 Score: 55.8 bits (133), Expect = 7.440e-8 Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VSVLLLPLYFA SGLKT++ + +ATSWGI + I ACVG+ Sbjct: 327 VSVLLLPLYFASSGLKTNVASIKDATSWGILALVICTACVGK 368
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A444G2R7_ENSVE (Na_H_Exchanger domain-containing protein n=3 Tax=Musaceae TaxID=4637 RepID=A0A444G2R7_ENSVE) HSP 1 Score: 55.8 bits (133), Expect = 7.450e-8 Identity = 27/42 (64.29%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VSVLLLPLYFA SGLKT++ + +ATSWGI + I ACVG+ Sbjct: 327 VSVLLLPLYFASSGLKTNVASIKDATSWGILALVICTACVGK 368
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: UPI001CC3E62E (cation/H(+) antiporter 20-like n=1 Tax=Telopea speciosissima TaxID=54955 RepID=UPI001CC3E62E) HSP 1 Score: 55.1 bits (131), Expect = 1.390e-7 Identity = 27/42 (64.29%), Postives = 32/42 (76.19%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VS LLLPLYFA SGLKTD+T + A SWG+ V+ I ACVG+ Sbjct: 318 VSGLLLPLYFASSGLKTDVTKIHGAESWGLLVLVIVTACVGK 359
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A176W4H5_MARPO (Na_H_Exchanger domain-containing protein n=2 Tax=Marchantia polymorpha TaxID=3197 RepID=A0A176W4H5_MARPO) HSP 1 Score: 54.7 bits (130), Expect = 1.910e-7 Identity = 26/42 (61.90%), Postives = 33/42 (78.57%), Query Frame = 0 Query: 2 VSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 VSVL+LPLYFA SGLKT++ + A SWG+ V+ IA ACVG+ Sbjct: 316 VSVLMLPLYFASSGLKTNVATIAGAQSWGLLVLVIAVACVGK 357
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: UPI001263A75A (cation/H(+) antiporter 19-like n=1 Tax=Pistacia vera TaxID=55513 RepID=UPI001263A75A) HSP 1 Score: 54.7 bits (130), Expect = 1.910e-7 Identity = 25/43 (58.14%), Postives = 33/43 (76.74%), Query Frame = 0 Query: 1 MVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 +VS LLLPLYFA SGLKTD+T ++ A SWG+ ++ I AC G+ Sbjct: 316 LVSALLLPLYFASSGLKTDVTTMNGALSWGLLLLVICTACFGK 358
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Match: A0A1J3DKG9_NOCCA (Cation/H(+) antiporter 19 (Fragment) n=1 Tax=Noccaea caerulescens TaxID=107243 RepID=A0A1J3DKG9_NOCCA) HSP 1 Score: 52.0 bits (123), Expect = 2.220e-7 Identity = 25/43 (58.14%), Postives = 31/43 (72.09%), Query Frame = 0 Query: 1 MVSVLLLPLYFAVSGLKTDLTLLDNATSWGICVITIAAACVGE 43 +VS LLLPLYFA SGLKTD+T + A SWG+ V+ I C G+ Sbjct: 54 LVSGLLLPLYFASSGLKTDVTTIKGAQSWGLLVLVILTTCFGK 96 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig102365.206.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25 ZOOMx 1POSITION0
Pagesback to topInterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-elongata_contig102365.206.1 ID=prot_H-elongata_contig102365.206.1|Name=mRNA_H-elongata_contig102365.206.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=45bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|