mRNA_H-elongata_contig100496.50.1 (mRNA) Himanthalia elongata Himel1 dioecious
You are viewing an mRNA, more information available on the corresponding polypeptide page
Overview
Homology
BLAST of mRNA_H-elongata_contig100496.50.1 vs. uniprot
Match: D8LP13_ECTSI (Vacuolar protein 8 n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D8LP13_ECTSI) HSP 1 Score: 73.9 bits (180), Expect = 2.960e-14 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 1 VWRQQTAVRLLCMNVENLFLFFVQRLSNLAGSRRFHNDALRANG 132 VWR +TA+RLLC +V+ LFLFF QRL+NLAGSRR HNDALRANG Sbjct: 1743 VWRHRTAIRLLCTSVDGLFLFFAQRLANLAGSRRTHNDALRANG 1786
BLAST of mRNA_H-elongata_contig100496.50.1 vs. uniprot
Match: A0A6H5KXM7_9PHAE (Vacuolar protein 8 n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KXM7_9PHAE) HSP 1 Score: 73.9 bits (180), Expect = 2.970e-14 Identity = 34/44 (77.27%), Postives = 39/44 (88.64%), Query Frame = 1 Query: 1 VWRQQTAVRLLCMNVENLFLFFVQRLSNLAGSRRFHNDALRANG 132 VWR +TA+RLLC +V+ LFLFF QRL+NLAGSRR HNDALRANG Sbjct: 421 VWRHRTAIRLLCTSVDTLFLFFAQRLANLAGSRRTHNDALRANG 464
BLAST of mRNA_H-elongata_contig100496.50.1 vs. uniprot
Match: A0A7S3URI4_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3URI4_HETAK) HSP 1 Score: 51.2 bits (121), Expect = 2.930e-6 Identity = 22/43 (51.16%), Postives = 33/43 (76.74%), Query Frame = 1 Query: 4 WRQQTAVRLLCMNVENLFLFFVQRLSNLAGSRRFHNDALRANG 132 W+ ++ +L +V++LFLFF QRL+NLAG+RR +N+ LR NG Sbjct: 67 WQNLASIYILFTDVDSLFLFFAQRLANLAGARRMYNERLRENG 109 The following BLAST results are available for this feature:
BLAST of mRNA_H-elongata_contig100496.50.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 3 ZOOMx 1POSITION0
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-elongata_contig100496.50.1 >prot_H-elongata_contig100496.50.1 ID=prot_H-elongata_contig100496.50.1|Name=mRNA_H-elongata_contig100496.50.1|organism=Himanthalia elongata Himel1 dioecious|type=polypeptide|length=44bp VWRQQTAVRLLCMNVENLFLFFVQRLSNLAGSRRFHNDALRANGback to top mRNA from alignment at H-elongata_contig100496:1380..1511+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-elongata_contig100496.50.1 ID=mRNA_H-elongata_contig100496.50.1|Name=mRNA_H-elongata_contig100496.50.1|organism=Himanthalia elongata Himel1 dioecious|type=mRNA|length=132bp|location=Sequence derived from alignment at H-elongata_contig100496:1380..1511+ (Himanthalia elongata Himel1 dioecious)back to top Coding sequence (CDS) from alignment at H-elongata_contig100496:1380..1511+ >mRNA_H-elongata_contig100496.50.1 ID=mRNA_H-elongata_contig100496.50.1|Name=mRNA_H-elongata_contig100496.50.1|organism=Himanthalia elongata Himel1 dioecious|type=CDS|length=264bp|location=Sequence derived from alignment at H-elongata_contig100496:1380..1511+ (Himanthalia elongata Himel1 dioecious)back to top |