prot_H-akashiwo_Contig1030.9.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: A0A443SPK6_9ACAR (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like protein n=1 Tax=Leptotrombidium deliense TaxID=299467 RepID=A0A443SPK6_9ACAR) HSP 1 Score: 52.0 bits (123), Expect = 7.090e-6 Identity = 29/65 (44.62%), Postives = 42/65 (64.62%), Query Frame = 0 Query: 1 MNGHEAVVRLLIRHGAALHFMPRYFGPA---LHMAVARGHSNIVKELVFAGANVNQRDNQGMTAI 62 ++G+ V+ LLI+ G + R G LH+A A+GH NIVK+L+ GANVN +D +G+TAI Sbjct: 44 IDGNSFVLDLLIKEGVSFDDTDRPKGALCDPLHVASAKGHLNIVKQLIAYGANVNAKDYRGITAI 108
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: UPI000440F689 (ankyrin n=1 Tax=Stereum hirsutum (strain FP-91666) TaxID=721885 RepID=UPI000440F689) HSP 1 Score: 46.6 bits (109), Expect = 4.550e-5 Identity = 23/61 (37.70%), Postives = 39/61 (63.93%), Query Frame = 0 Query: 2 NGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAI 62 +G + R L+ A + + ALH+AV+ GH ++ KELV AGA+VN+R+++G+T + Sbjct: 2 SGSVDIARYLVDQKADIDKVDASGWSALHIAVSAGHEDVTKELVGAGADVNKRNDKGLTPL 62
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: A0A0C9VB06_9AGAM (Uncharacterized protein n=1 Tax=Hydnomerulius pinastri MD-312 TaxID=994086 RepID=A0A0C9VB06_9AGAM) HSP 1 Score: 45.8 bits (107), Expect = 9.770e-5 Identity = 19/35 (54.29%), Postives = 31/35 (88.57%), Query Frame = 0 Query: 28 ALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAI 62 ALH+AV+ GH ++V+ELV AGA+VNQ++++G+T + Sbjct: 27 ALHIAVSAGHEDVVQELVGAGADVNQKNDKGLTPL 61 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig1030.9.1 ID=prot_H-akashiwo_Contig1030.9.1|Name=mRNA_H-akashiwo_Contig1030.9.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=80bpback to top |