mRNA_H-akashiwo_Contig1030.9.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: A0A443SPK6_9ACAR (Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B-like protein n=1 Tax=Leptotrombidium deliense TaxID=299467 RepID=A0A443SPK6_9ACAR) HSP 1 Score: 59.3 bits (142), Expect = 2.390e-8 Identity = 32/72 (44.44%), Postives = 48/72 (66.67%), Query Frame = 1 Query: 1 TPLICAAMNGHEAVVRLLIRHGAALHFMPRYFGPA---LHMAVARGHSNIVKELVFAGANVNQRDNQGMTAI 207 +P++ AA++G+ V+ LLI+ G + R G LH+A A+GH NIVK+L+ GANVN +D +G+TAI Sbjct: 37 SPILYAAIDGNSFVLDLLIKEGVSFDDTDRPKGALCDPLHVASAKGHLNIVKQLIAYGANVNAKDYRGITAI 108
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: A0A8C5QFH0_9ANUR (Ubiquitin-like domain-containing protein n=2 Tax=Leptobrachium leishanense TaxID=445787 RepID=A0A8C5QFH0_9ANUR) HSP 1 Score: 50.4 bits (119), Expect = 3.050e-5 Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 1 Query: 7 LICAAMNGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAIDL 213 L AA GH VVR L+++GA + ALH+A A+G+ + + EL+ GA +N G+TA++L Sbjct: 144 LFIAAHRGHLGVVRFLLKNGANVLAKTPLGNSALHVAAAKGNCDCITELLAHGAQTEDTNNDGVTALEL 212
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: UPI000440F689 (ankyrin n=1 Tax=Stereum hirsutum (strain FP-91666) TaxID=721885 RepID=UPI000440F689) HSP 1 Score: 47.0 bits (110), Expect = 4.070e-5 Identity = 23/61 (37.70%), Postives = 39/61 (63.93%), Query Frame = 1 Query: 25 NGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAI 207 +G + R L+ A + + ALH+AV+ GH ++ KELV AGA+VN+R+++G+T + Sbjct: 2 SGSVDIARYLVDQKADIDKVDASGWSALHIAVSAGHEDVTKELVGAGADVNKRNDKGLTPL 62
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: UPI001BFDA9BE (ankyrin repeat domain-containing protein n=1 Tax=Polynucleobacter sp. MWH-Aus1W21 TaxID=1855880 RepID=UPI001BFDA9BE) HSP 1 Score: 49.7 bits (117), Expect = 4.700e-5 Identity = 27/71 (38.03%), Postives = 44/71 (61.97%), Query Frame = 1 Query: 1 TPLICAAMNGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAIDL 213 TPL A NGH + + LI +GA++ + + L MAV G+ +VK L+ GA++ R++QG++AID+ Sbjct: 129 TPLHYACANGHLDIAQFLIANGASIDSLSQGNTTPLMMAVQSGNEVLVKLLLDKGADLQLRNSQGLSAIDI 199
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: A0A7S2NCL6_9EUKA (Hypothetical protein (Fragment) n=2 Tax=Haptolina brevifila TaxID=156173 RepID=A0A7S2NCL6_9EUKA) HSP 1 Score: 49.3 bits (116), Expect = 8.270e-5 Identity = 26/76 (34.21%), Postives = 45/76 (59.21%), Query Frame = 1 Query: 1 TPLICAAMNGHEAVVRLLIRHGAALHFMPRYFG-PALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAIDLNEQF 225 T L+ AA++G + ++ L+ GA ++F G AL AV GH+++V++L+ AGA+V + G TA L ++ Sbjct: 173 TLLVLAAISGQKELISFLLSRGANVNFQSCITGYSALMWAVHEGHTDVVRQLIMAGADVKRHSKHGYTARSLAKKL 248
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Match: UPI001C0D2ECD (ankyrin repeat domain-containing protein n=3 Tax=Polynucleobacter TaxID=44013 RepID=UPI001C0D2ECD) HSP 1 Score: 48.9 bits (115), Expect = 8.990e-5 Identity = 28/71 (39.44%), Postives = 43/71 (60.56%), Query Frame = 1 Query: 1 TPLICAAMNGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANVNQRDNQGMTAIDL 213 TPL A GH V + LI +GAA+ + + L MAV G+ +VK L+ GA++ R++QG++AID+ Sbjct: 129 TPLHYACARGHLDVAQFLIANGAAIDSLSQGNTTPLMMAVQSGNEVLVKLLLDKGADLQLRNSQGLSAIDI 199 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1030.9.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 6
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig1030.9.1 >prot_H-akashiwo_Contig1030.9.1 ID=prot_H-akashiwo_Contig1030.9.1|Name=mRNA_H-akashiwo_Contig1030.9.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=80bp MNGHEAVVRLLIRHGAALHFMPRYFGPALHMAVARGHSNIVKELVFAGANback to top mRNA from alignment at H-akashiwo_Contig1030:316638..316898+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig1030.9.1 ID=mRNA_H-akashiwo_Contig1030.9.1|Name=mRNA_H-akashiwo_Contig1030.9.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=261bp|location=Sequence derived from alignment at H-akashiwo_Contig1030:316638..316898+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig1030:316638..316898+ >mRNA_H-akashiwo_Contig1030.9.1 ID=mRNA_H-akashiwo_Contig1030.9.1|Name=mRNA_H-akashiwo_Contig1030.9.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=240bp|location=Sequence derived from alignment at H-akashiwo_Contig1030:316638..316898+ (Heterosigma akashiwo CCMP452)back to top |