mRNA_H-akashiwo_Contig81.41.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A7S3USK8_HETAK (Hypothetical protein (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3USK8_HETAK) HSP 1 Score: 129 bits (323), Expect = 3.850e-36 Identity = 61/61 (100.00%), Postives = 61/61 (100.00%), Query Frame = 1 Query: 1 SVCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 SVCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE Sbjct: 107 SVCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 167
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A090AHW0_9GAMM (NUDIX hydrolase n=1 Tax=Thioploca ingrica TaxID=40754 RepID=A0A090AHW0_9GAMM) HSP 1 Score: 65.9 bits (159), Expect = 4.200e-11 Identity = 35/60 (58.33%), Postives = 42/60 (70.00%), Query Frame = 1 Query: 4 VCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 V PY+ P P EV+LIKEFRSP +T D F+HELPGGS+FK EP+ A+ ELHEE Sbjct: 248 VVPYWKHP--TDPLASEVILIKEFRSPGRTKDGFVHELPGGSSFKKGEPLQIASDELHEE 305
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A496V7H5_9GAMM (NUDIX hydrolase n=2 Tax=Gammaproteobacteria TaxID=1236 RepID=A0A496V7H5_9GAMM) HSP 1 Score: 61.2 bits (147), Expect = 1.830e-9 Identity = 30/46 (65.22%), Postives = 36/46 (78.26%), Query Frame = 1 Query: 46 DCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 D E+VLIKEFRSPA+T D F+HELPGGSAFK + A+ EL+EE Sbjct: 262 DSEIVLIKEFRSPARTKDGFVHELPGGSAFKRSGILQVASDELYEE 307
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A496VW41_9GAMM (NUDIX hydrolase n=1 Tax=Gammaproteobacteria bacterium TaxID=1913989 RepID=A0A496VW41_9GAMM) HSP 1 Score: 60.1 bits (144), Expect = 4.680e-9 Identity = 35/61 (57.38%), Postives = 41/61 (67.21%), Query Frame = 1 Query: 4 VCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAAS-ELHEE 183 V PY+ P P E+VLIKEFRSPA+T D F+HELPGGS FK ++ AS ELHEE Sbjct: 250 VVPYWKHP--TDPLQSEIVLIKEFRSPARTADGFVHELPGGSNFKTGNDQLQLASDELHEE 308
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A0G1AVP6_9BACT (Uncharacterized protein n=2 Tax=Parcubacteria group TaxID=1794811 RepID=A0A0G1AVP6_9BACT) HSP 1 Score: 59.3 bits (142), Expect = 8.740e-9 Identity = 29/44 (65.91%), Postives = 35/44 (79.55%), Query Frame = 1 Query: 55 VVLIKEFRSPAKTDDCFIHELPGGSAFKAQ-EPVVEAASELHEE 183 +VL+KEFRSP +T D FIHELPGGSAFK EP++ AA E+ EE Sbjct: 255 IVLVKEFRSPGRTSDGFIHELPGGSAFKNNVEPIILAAEEIFEE 298
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: UPI001F2566FB (hypothetical protein n=1 Tax=Amycolatopsis sp. GM8 TaxID=2896530 RepID=UPI001F2566FB) HSP 1 Score: 58.2 bits (139), Expect = 2.240e-8 Identity = 27/46 (58.70%), Postives = 34/46 (73.91%), Query Frame = 1 Query: 46 DCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 D EVV+++EFRSPA T D F+ ELPGGS FK P+ +A +EL EE Sbjct: 254 DTEVVIVREFRSPATTADGFVRELPGGSGFKPASPIEQAVAELAEE 299
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: UPI001E3EFF15 (NUDIX domain-containing protein n=1 Tax=Streptomyces kaniharaensis TaxID=212423 RepID=UPI001E3EFF15) HSP 1 Score: 55.8 bits (133), Expect = 3.900e-8 Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 46 DCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 D E+VL++EFRSPA+T D +I E+PGGS+ K +P V AA+E EE Sbjct: 20 DTEIVLVREFRSPARTPDAYIREVPGGSSAKPGDPRVTAATEFTEE 65
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A3D0YSH6_9BACT (NUDIX hydrolase n=1 Tax=Candidatus Falkowbacteria bacterium TaxID=2053554 RepID=A0A3D0YSH6_9BACT) HSP 1 Score: 56.2 bits (134), Expect = 1.070e-7 Identity = 31/47 (65.96%), Postives = 36/47 (76.60%), Query Frame = 1 Query: 46 DCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQE-PVVEAASELHEE 183 D +VVLI+EFRSPA TDD FI E+PGGS++K E P V AA EL EE Sbjct: 249 DSQVVLIREFRSPATTDDGFIREVPGGSSWKPGENPFVTAAHELAEE 295
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A6N7L3M4_9ACTN (NUDIX hydrolase n=1 Tax=Streptomyces kaniharaensis TaxID=212423 RepID=A0A6N7L3M4_9ACTN) HSP 1 Score: 55.8 bits (133), Expect = 1.470e-7 Identity = 26/46 (56.52%), Postives = 35/46 (76.09%), Query Frame = 1 Query: 46 DCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPVVEAASELHEE 183 D E+VL++EFRSPA+T D +I E+PGGS+ K +P V AA+E EE Sbjct: 249 DTEIVLVREFRSPARTPDAYIREVPGGSSAKPGDPRVTAATEFTEE 294
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Match: A0A6J5RX26_9CAUD (Nucleoside 2-deoxyribosyltransferase like n=1 Tax=uncultured Caudovirales phage TaxID=2100421 RepID=A0A6J5RX26_9CAUD) HSP 1 Score: 55.8 bits (133), Expect = 1.470e-7 Identity = 29/48 (60.42%), Postives = 37/48 (77.08%), Query Frame = 1 Query: 43 EDCEVVLIKEFRSPAKTDDCFIHELPGGSA-FKAQEPVVEAASELHEE 183 E+ EVV+IKEFRSPA+T+D FI EL GGS+ K +P+ AA E+HEE Sbjct: 260 ENSEVVIIKEFRSPARTEDGFIRELAGGSSPKKGSDPLETAAEEIHEE 307 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig81.41.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig81.41.1 >prot_H-akashiwo_Contig81.41.1 ID=prot_H-akashiwo_Contig81.41.1|Name=mRNA_H-akashiwo_Contig81.41.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=61bp SVCPYYVPPGAQGPEDCEVVLIKEFRSPAKTDDCFIHELPGGSAFKAQEPback to top mRNA from alignment at H-akashiwo_Contig81:1629481..1629664+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig81.41.1 ID=mRNA_H-akashiwo_Contig81.41.1|Name=mRNA_H-akashiwo_Contig81.41.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=184bp|location=Sequence derived from alignment at H-akashiwo_Contig81:1629481..1629664+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig81:1629481..1629664+ >mRNA_H-akashiwo_Contig81.41.1 ID=mRNA_H-akashiwo_Contig81.41.1|Name=mRNA_H-akashiwo_Contig81.41.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=183bp|location=Sequence derived from alignment at H-akashiwo_Contig81:1629481..1629664+ (Heterosigma akashiwo CCMP452)back to top |