prot_H-akashiwo_Contig977.2.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A6V1VKR3_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1VKR3_HETAK) HSP 1 Score: 104 bits (260), Expect = 5.880e-26 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 0 Query: 1 SAQRPSTILGTSPISGGSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK 50 SAQRPSTILGTSPISGGSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK Sbjct: 60 SAQRPSTILGTSPISGGSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK 109
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A7S3FHQ0_9VIRI (Hypothetical protein n=2 Tax=Prasinoderma singulare TaxID=676789 RepID=A0A7S3FHQ0_9VIRI) HSP 1 Score: 49.7 bits (117), Expect = 1.300e-5 Identity = 21/37 (56.76%), Postives = 29/37 (78.38%), Query Frame = 0 Query: 14 ISGGSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK 50 + GG R+ IKP LP++++YDHCP+C RVR+ LGLK Sbjct: 26 VKGGPPRV-IKP-VLPKIYVYDHCPFCVRVRLALGLK 60
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A662XZA8_9STRA (GST N-terminal domain-containing protein n=1 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662XZA8_9STRA) HSP 1 Score: 48.9 bits (115), Expect = 2.340e-5 Identity = 17/27 (62.96%), Postives = 22/27 (81.48%), Query Frame = 0 Query: 24 KPQALPRVFLYDHCPYCTRVRIILGLK 50 K + LP++F+YDHCPYC R R+I GLK Sbjct: 33 KAEPLPKLFIYDHCPYCVRARVIFGLK 59
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A067C5M8_SAPPC (GST N-terminal domain-containing protein n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067C5M8_SAPPC) HSP 1 Score: 47.8 bits (112), Expect = 6.250e-5 Identity = 20/37 (54.05%), Postives = 27/37 (72.97%), Query Frame = 0 Query: 15 SGGSDRLAIKPQ-ALPRVFLYDHCPYCTRVRIILGLK 50 + S +LA K ALPR+++YDHCP+C R R+I GLK Sbjct: 33 AAASKKLAAKAAPALPRLYIYDHCPFCVRTRMIFGLK 69
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A0G4H2N0_9ALVE (Uncharacterized protein n=2 Tax=Chromera velia CCMP2878 TaxID=1169474 RepID=A0A0G4H2N0_9ALVE) HSP 1 Score: 47.8 bits (112), Expect = 6.440e-5 Identity = 22/49 (44.90%), Postives = 31/49 (63.27%), Query Frame = 0 Query: 2 AQRPSTILGTSPISGGSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK 50 A+ PS + P DR+ + P LP++++YDHCP+C R RII GLK Sbjct: 35 AESPSRLAAVVP----DDRI-VPPGPLPQLYVYDHCPFCVRARIIFGLK 78
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A7S2V214_9STRA (Hypothetical protein n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2V214_9STRA) HSP 1 Score: 47.8 bits (112), Expect = 6.540e-5 Identity = 24/55 (43.64%), Postives = 34/55 (61.82%), Query Frame = 0 Query: 1 SAQRPSTILGTSPISG-----GSDRLAIKPQALPRVFLYDHCPYCTRVRIILGLK 50 S RP+ L S +S + R+ + P LP+V++YDHCP+C RVR+ LGLK Sbjct: 32 SITRPNIGLSMSAVSAPVSVPAAPRIVLDP--LPKVYVYDHCPFCVRVRLALGLK 84
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A7S2XXQ8_9STRA (Hypothetical protein (Fragment) n=1 Tax=Fibrocapsa japonica TaxID=94617 RepID=A0A7S2XXQ8_9STRA) HSP 1 Score: 47.4 bits (111), Expect = 8.840e-5 Identity = 23/48 (47.92%), Postives = 31/48 (64.58%), Query Frame = 0 Query: 4 RPSTILGTSPISGGSD-RLAIKPQALPRVFLYDHCPYCTRVRIILGLK 50 R S+ L TS +S SD K LP++++YDHCP+C R R+I GLK Sbjct: 48 RASSALSTSSLSYCSDDEKPKKKNYLPQLYIYDHCPFCVRARMIFGLK 95
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Match: A0A061QZU5_9CHLO (Family glutaredoxin (Fragment) n=1 Tax=Tetraselmis sp. GSL018 TaxID=582737 RepID=A0A061QZU5_9CHLO) HSP 1 Score: 47.4 bits (111), Expect = 9.040e-5 Identity = 16/28 (57.14%), Postives = 22/28 (78.57%), Query Frame = 0 Query: 23 IKPQALPRVFLYDHCPYCTRVRIILGLK 50 + P LP+V++YDHCP+C RVR+ LG K Sbjct: 73 VVPDTLPKVYVYDHCPFCVRVRVALGYK 100 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig977.2.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 8
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig977.2.1 ID=prot_H-akashiwo_Contig977.2.1|Name=mRNA_H-akashiwo_Contig977.2.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=50bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|