prot_H-akashiwo_Contig948.1.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig948.1.1 vs. uniprot
Match: A0A814JN61_9BILA (Hypothetical protein n=1 Tax=Didymodactylos carnosus TaxID=1234261 RepID=A0A814JN61_9BILA) HSP 1 Score: 59.3 bits (142), Expect = 4.400e-8 Identity = 36/88 (40.91%), Postives = 47/88 (53.41%), Query Frame = 0 Query: 4 VIVGGGIAGKSLAAFLRARGIPFTLLSGSSNAVLS-RPDFGIGIWSPALIKFKELGILPNLEREGSYIGVSGYK-AMNGQWLAQPSPL 89 +I+GGGIAG +LA IPF L S+ R GIG+W PAL LGI L +G + +GY+ + G WLA+P PL Sbjct: 53 LIIGGGIAGLTLARACTIAKIPFKLFEQSTQLQSDKRAGTGIGLWGPALRALYTLGITDKLYSKGQLMICAGYRDSHTGNWLAKPHPL 140 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig948.1.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig948.1.1 ID=prot_H-akashiwo_Contig948.1.1|Name=mRNA_H-akashiwo_Contig948.1.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=101bpback to top Annotated Terms
The following terms have been associated with this polypeptide:
|