mRNA_H-akashiwo_Contig948.1.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig948.1.1 vs. uniprot
Match: A0A814JN61_9BILA (Hypothetical protein n=1 Tax=Didymodactylos carnosus TaxID=1234261 RepID=A0A814JN61_9BILA) HSP 1 Score: 59.3 bits (142), Expect = 4.400e-8 Identity = 36/88 (40.91%), Postives = 47/88 (53.41%), Query Frame = 1 Query: 10 VIVGGGIAGKSLAAFLRARGIPFTLLSGSSNAVLS-RPDFGIGIWSPALIKFKELGILPNLEREGSYIGVSGYK-AMNGQWLAQPSPL 267 +I+GGGIAG +LA IPF L S+ R GIG+W PAL LGI L +G + +GY+ + G WLA+P PL Sbjct: 53 LIIGGGIAGLTLARACTIAKIPFKLFEQSTQLQSDKRAGTGIGLWGPALRALYTLGITDKLYSKGQLMICAGYRDSHTGNWLAKPHPL 140 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig948.1.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig948.1.1 >prot_H-akashiwo_Contig948.1.1 ID=prot_H-akashiwo_Contig948.1.1|Name=mRNA_H-akashiwo_Contig948.1.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=101bp MVNVIVGGGIAGKSLAAFLRARGIPFTLLSGSSNAVLSRPDFGIGIWSPAback to top mRNA from alignment at H-akashiwo_Contig948:24250..25178+ Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig948.1.1 ID=mRNA_H-akashiwo_Contig948.1.1|Name=mRNA_H-akashiwo_Contig948.1.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=929bp|location=Sequence derived from alignment at H-akashiwo_Contig948:24250..25178+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig948:24250..25178+ >mRNA_H-akashiwo_Contig948.1.1 ID=mRNA_H-akashiwo_Contig948.1.1|Name=mRNA_H-akashiwo_Contig948.1.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=303bp|location=Sequence derived from alignment at H-akashiwo_Contig948:24250..25178+ (Heterosigma akashiwo CCMP452)back to top |