prot_H-akashiwo_Contig1011.3.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1011.3.1 vs. uniprot
Match: A0A7S3XPM9_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3XPM9_HETAK) HSP 1 Score: 64.3 bits (155), Expect = 2.720e-10 Identity = 33/60 (55.00%), Postives = 41/60 (68.33%), Query Frame = 0 Query: 1 MSNISYTALTCALLGAPFLLVMILFWANVSEGDAFGKILDVTGDFNDGSIALIFPGLLYM 60 M +IS+ LT LLG PF +VM LF+ VSEG+AFG ILDVTG G I+L PGL+ + Sbjct: 185 MGSISFILLTVVLLGMPFAVVMALFFFQVSEGEAFGYILDVTGALCTGLISLTLPGLIVL 244
BLAST of mRNA_H-akashiwo_Contig1011.3.1 vs. uniprot
Match: A0A6V1M2K4_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V1M2K4_HETAK) HSP 1 Score: 53.1 bits (126), Expect = 3.010e-6 Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 0 Query: 6 YTALTCALLGAPFLLVMILFWANVSEGDAFGKILDVTGDFNDGSIALIFPGLLY 59 Y +T LL +VM+L++A VSEGDAFG ILD+TG + + + PG+ Y Sbjct: 234 YVVVTVGLLTFSLGVVMVLYYAGVSEGDAFGYILDLTGGVGNAMLGFVLPGIFY 287
BLAST of mRNA_H-akashiwo_Contig1011.3.1 vs. uniprot
Match: A0A6V2Y555_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6V2Y555_HETAK) HSP 1 Score: 53.1 bits (126), Expect = 3.170e-6 Identity = 24/54 (44.44%), Postives = 34/54 (62.96%), Query Frame = 0 Query: 6 YTALTCALLGAPFLLVMILFWANVSEGDAFGKILDVTGDFNDGSIALIFPGLLY 59 Y +T LL +VM+L++A VSEGDAFG ILD+TG + + + PG+ Y Sbjct: 370 YVVVTVGLLTFSLGVVMVLYYAGVSEGDAFGYILDLTGGVGNAMLGFVLPGIFY 423 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1011.3.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 3
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig1011.3.1 ID=prot_H-akashiwo_Contig1011.3.1|Name=mRNA_H-akashiwo_Contig1011.3.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=83bpback to top |