prot_H-akashiwo_Contig10.120.1 (polypeptide) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Match: A0A835YR37_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR37_9STRA) HSP 1 Score: 66.2 bits (160), Expect = 1.900e-11 Identity = 28/46 (60.87%), Postives = 38/46 (82.61%), Query Frame = 0 Query: 2 AEIAPTEADSTRSRKKFIAYKKELAKCQQGGLGVNVCQDIMSKYTA 47 A A D++ +R+++IAYKKELAKCQQGGLGVNVCQ+++ +YTA Sbjct: 391 AVAAEPAGDASSARRRYIAYKKELAKCQQGGLGVNVCQNLLERYTA 436
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Match: A0A0G4G2V7_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4G2V7_VITBC) HSP 1 Score: 51.2 bits (121), Expect = 3.560e-6 Identity = 21/41 (51.22%), Postives = 30/41 (73.17%), Query Frame = 0 Query: 4 IAPTEADSTRSRKKFIAYKKELAKCQQGGLGVNVCQDIMSK 44 + P+ +D + R K+I KK LAKCQQGG+GVNVC D++ + Sbjct: 238 LLPSASDDSPRRDKYIKIKKVLAKCQQGGVGVNVCGDVLKQ 278 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-akashiwo_Contig10.120.1 ID=prot_H-akashiwo_Contig10.120.1|Name=mRNA_H-akashiwo_Contig10.120.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=49bpback to top |