mRNA_H-akashiwo_Contig10.120.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Match: A0A835YR37_9STRA (Uncharacterized protein n=1 Tax=Tribonema minus TaxID=303371 RepID=A0A835YR37_9STRA) HSP 1 Score: 64.7 bits (156), Expect = 1.660e-9 Identity = 29/49 (59.18%), Postives = 39/49 (79.59%), Query Frame = 1 Query: 43 VAMAEIAPTEADSTRSRKKFIAYKKELAKCQQGGLGVNVCQDIMSKYTA 189 V A A D++ +R+++IAYKKELAKCQQGGLGVNVCQ+++ +YTA Sbjct: 388 VLAAVAAEPAGDASSARRRYIAYKKELAKCQQGGLGVNVCQNLLERYTA 436
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Match: A0A0G4G2V7_VITBC (Uncharacterized protein n=1 Tax=Vitrella brassicaformis (strain CCMP3155) TaxID=1169540 RepID=A0A0G4G2V7_VITBC) HSP 1 Score: 52.4 bits (124), Expect = 2.760e-5 Identity = 25/54 (46.30%), Postives = 36/54 (66.67%), Query Frame = 1 Query: 19 ELNARQSRVAMAEIAPTEADSTRSRKKFIAYKKELAKCQQGGLGVNVCQDIMSK 180 +L A + VA + P+ +D + R K+I KK LAKCQQGG+GVNVC D++ + Sbjct: 225 QLIAEPAEVAPFTLLPSASDDSPRRDKYIKIKKVLAKCQQGGVGVNVCGDVLKQ 278 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig10.120.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig10.120.1 >prot_H-akashiwo_Contig10.120.1 ID=prot_H-akashiwo_Contig10.120.1|Name=mRNA_H-akashiwo_Contig10.120.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=49bp MAEIAPTEADSTRSRKKFIAYKKELAKCQQGGLGVNVCQDIMSKYTAK*back to top mRNA from alignment at H-akashiwo_Contig10:5374977..5375743+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig10.120.1 ID=mRNA_H-akashiwo_Contig10.120.1|Name=mRNA_H-akashiwo_Contig10.120.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=767bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5374977..5375743+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig10:5374977..5375743+ >mRNA_H-akashiwo_Contig10.120.1 ID=mRNA_H-akashiwo_Contig10.120.1|Name=mRNA_H-akashiwo_Contig10.120.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=147bp|location=Sequence derived from alignment at H-akashiwo_Contig10:5374977..5375743+ (Heterosigma akashiwo CCMP452)back to top |