mRNA_H-akashiwo_Contig9.53.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A7S4D679_HETAK (Dihydroorotate dehydrogenase (quinone), mitochondrial (Fragment) n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S4D679_HETAK) HSP 1 Score: 115 bits (288), Expect = 8.490e-30 Identity = 50/50 (100.00%), Postives = 50/50 (100.00%), Query Frame = 3 Query: 3 AMPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 AMPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL Sbjct: 116 AMPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 165
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A0P1A445_PLAHL (Dihydroorotate dehydrogenase (quinone), mitochondrial n=1 Tax=Plasmopara halstedii TaxID=4781 RepID=A0A0P1A445_PLAHL) HSP 1 Score: 61.6 bits (148), Expect = 8.450e-10 Identity = 28/49 (57.14%), Postives = 35/49 (71.43%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP +R+FDPETAHNIAV +GL P+D +P L+V GLKF+NPL Sbjct: 64 MPVIRIFDPETAHNIAVQCARFGLIPKDPEPDPKLLHVHALGLKFSNPL 112
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: D0MUE3_PHYIT (Dihydroorotate dehydrogenase (quinone), mitochondrial n=5 Tax=Phytophthora TaxID=4783 RepID=D0MUE3_PHYIT) HSP 1 Score: 59.3 bits (142), Expect = 5.540e-9 Identity = 27/49 (55.10%), Postives = 33/49 (67.35%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP VRMF+PETAH IAV +GL P+D +P L+V GL+F NPL Sbjct: 68 MPVVRMFEPETAHKIAVQCARFGLTPKDPETDPELLHVQVLGLEFTNPL 116
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A8K1C5T7_PYTOL (Uncharacterized protein n=1 Tax=Pythium oligandrum TaxID=41045 RepID=A0A8K1C5T7_PYTOL) HSP 1 Score: 59.3 bits (142), Expect = 5.540e-9 Identity = 29/49 (59.18%), Postives = 33/49 (67.35%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP VR+FDPETAH IAV TTA GL P D +P +L V G +F NPL Sbjct: 78 MPIVRLFDPETAHVIAVKTTALGLAPVDTEVDPESLRVKVLGREFPNPL 126
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: C1EIH8_MICCC (Dihydroorotate dehydrogenase (quinone), mitochondrial n=1 Tax=Micromonas commoda (strain RCC299 / NOUM17 / CCMP2709) TaxID=296587 RepID=C1EIH8_MICCC) HSP 1 Score: 58.5 bits (140), Expect = 1.040e-8 Identity = 25/48 (52.08%), Postives = 34/48 (70.83%), Query Frame = 3 Query: 9 PAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 PA+R+ DPETAHN+ + A G+ P + +PPAL VD GL+FANP+ Sbjct: 98 PAMRLMDPETAHNVGIELLARGVAPVETRRDPPALAVDAWGLRFANPI 145
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A225UVW3_9STRA (Dihydroorotate dehydrogenase (quinone), mitochondrial n=2 Tax=Phytophthora TaxID=4783 RepID=A0A225UVW3_9STRA) HSP 1 Score: 57.4 bits (137), Expect = 2.650e-8 Identity = 26/49 (53.06%), Postives = 31/49 (63.27%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP VR+FDPETAH +AV +GL P+D +P L V GL F NPL Sbjct: 66 MPVVRLFDPETAHKVAVQCARFGLTPKDPETDPELLQVQALGLTFPNPL 114
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A3R7FWP2_9STRA (Dihydroorotate dehydrogenase (quinone), mitochondrial n=4 Tax=Phytophthora kernoviae TaxID=325452 RepID=A0A3R7FWP2_9STRA) HSP 1 Score: 57.0 bits (136), Expect = 3.640e-8 Identity = 26/49 (53.06%), Postives = 31/49 (63.27%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP VR+FDPETAH IAV +GL P+D +P L + GL F NPL Sbjct: 2 MPVVRLFDPETAHKIAVQCARFGLTPKDPETDPELLRIKAFGLDFTNPL 50
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A3M6VCA1_9STRA (Dihydroorotate dehydrogenase (quinone), mitochondrial n=1 Tax=Peronospora effusa TaxID=542832 RepID=A0A3M6VCA1_9STRA) HSP 1 Score: 56.6 bits (135), Expect = 4.960e-8 Identity = 25/49 (51.02%), Postives = 33/49 (67.35%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP +R+FDPET+H IAV +GL P+D +P L+V GL+F NPL Sbjct: 66 MPVLRLFDPETSHQIAVQCARFGLTPKDPEEDPELLHVKALGLQFTNPL 114
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A662X2Z7_9STRA (Dihydroorotate dehydrogenase (quinone), mitochondrial n=2 Tax=Nothophytophthora sp. Chile5 TaxID=2483409 RepID=A0A662X2Z7_9STRA) HSP 1 Score: 55.1 bits (131), Expect = 1.730e-7 Identity = 27/49 (55.10%), Postives = 30/49 (61.22%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MP VRMFDPETAH IAV +GL P+D + L VD G F NPL Sbjct: 75 MPVVRMFDPETAHQIAVQCARFGLTPKDDQPDASLLAVDVFGQTFPNPL 123
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Match: A0A067BRA0_SAPPC (Dihydroorotate dehydrogenase (quinone), mitochondrial n=2 Tax=Saprolegnia TaxID=4769 RepID=A0A067BRA0_SAPPC) HSP 1 Score: 54.7 bits (130), Expect = 2.370e-7 Identity = 26/49 (53.06%), Postives = 32/49 (65.31%), Query Frame = 3 Query: 6 MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPL 152 MPAVR+FDPETAH +AV +GL P+D + P+L V L F NPL Sbjct: 62 MPAVRLFDPETAHILAVKAAKYGLIPKDKRHDDPSLQVTAFNLTFDNPL 110 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig9.53.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 22
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following UTR feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig9.53.1 >prot_H-akashiwo_Contig9.53.1 ID=prot_H-akashiwo_Contig9.53.1|Name=mRNA_H-akashiwo_Contig9.53.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=49bp MPAVRMFDPETAHNIAVMTTAWGLGPRDWFGNPPALNVDFCGLKFANPLback to top mRNA from alignment at H-akashiwo_Contig9:3403751..3404134- Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig9.53.1 ID=mRNA_H-akashiwo_Contig9.53.1|Name=mRNA_H-akashiwo_Contig9.53.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=384bp|location=Sequence derived from alignment at H-akashiwo_Contig9:3403751..3404134- (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig9:3403751..3404134- >mRNA_H-akashiwo_Contig9.53.1 ID=mRNA_H-akashiwo_Contig9.53.1|Name=mRNA_H-akashiwo_Contig9.53.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=147bp|location=Sequence derived from alignment at H-akashiwo_Contig9:3403751..3404134- (Heterosigma akashiwo CCMP452)back to top |