mRNA_H-akashiwo_Contig1038.4.1 (mRNA) Heterosigma akashiwo CCMP452
Overview
Homology
BLAST of mRNA_H-akashiwo_Contig1038.4.1 vs. uniprot
Match: A0A7S3YK38_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A7S3YK38_HETAK) HSP 1 Score: 90.1 bits (222), Expect = 4.320e-22 Identity = 48/48 (100.00%), Postives = 48/48 (100.00%), Query Frame = 3 Query: 3 VSSGRHGRQTGAGNHQQANAGYQVPQQQFRRPNNHQQATRSPQYQASS 146 VSSGRHGRQTGAGNHQQANAGYQVPQQQFRRPNNHQQATRSPQYQASS Sbjct: 19 VSSGRHGRQTGAGNHQQANAGYQVPQQQFRRPNNHQQATRSPQYQASS 66 The following BLAST results are available for this feature:
BLAST of mRNA_H-akashiwo_Contig1038.4.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-akashiwo_Contig1038.4.1 >prot_H-akashiwo_Contig1038.4.1 ID=prot_H-akashiwo_Contig1038.4.1|Name=mRNA_H-akashiwo_Contig1038.4.1|organism=Heterosigma akashiwo CCMP452|type=polypeptide|length=43bp MAGKPAPGTTSRLMLATKYPSSSSDAQITISRLLVAHSTKLPPback to top mRNA from alignment at H-akashiwo_Contig1038:214085..214713+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-akashiwo_Contig1038.4.1 ID=mRNA_H-akashiwo_Contig1038.4.1|Name=mRNA_H-akashiwo_Contig1038.4.1|organism=Heterosigma akashiwo CCMP452|type=mRNA|length=629bp|location=Sequence derived from alignment at H-akashiwo_Contig1038:214085..214713+ (Heterosigma akashiwo CCMP452)back to top Coding sequence (CDS) from alignment at H-akashiwo_Contig1038:214085..214713+ >mRNA_H-akashiwo_Contig1038.4.1 ID=mRNA_H-akashiwo_Contig1038.4.1|Name=mRNA_H-akashiwo_Contig1038.4.1|organism=Heterosigma akashiwo CCMP452|type=CDS|length=129bp|location=Sequence derived from alignment at H-akashiwo_Contig1038:214085..214713+ (Heterosigma akashiwo CCMP452)back to top |