prot_H-canaliculatus_F_contig10028.64.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female

You are viewing a polypeptide, more information available on the corresponding mRNA page

Homology
The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig10028.64.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90)
Total hits: 25
ZOOM
x 1
POSITION
0
MRRDCEHTSERTEPFLVLTAEVQDKDSLEGSLQLLVAGEMLSGDNCYLCEKCGQRVTAQRRCAIKQLPSTLIVHLKRFEFDLSTMRRHKLNHRCSFPMELDMAPWTLEVRRRGWTVCLASCPLVPSP102030405060708090100110120Expect = 8.74e-63 / Id = 97.17Expect = 3.02e-62 / Id = 96.23Expect = 9.06e-42 / Id = 73.40Expect = 4.77e-34 / Id = 57.55Expect = 3.32e-32 / Id = 51.20Expect = 3.51e-30 / Id = 56.19Expect = 4.54e-30 / Id = 50.96Expect = 8.85e-30 / Id = 54.72Expect = 1.17e-29 / Id = 54.37Expect = 1.65e-29 / Id = 52.73SequenceD8LU88_ECTSIA0A6H5KTV6_9PHAEA0A835YQG3_9STRAA0A7S4ITW2_9EUKAUPI000644FF27A0A0D2WMI0_CAPO3A0A6B2KX30_9EUKAL8GPA8_ACACAA0A4D9CWN0_9STRAA0A1Y2GGR1_9FUNG
Match NameE-valueIdentityDescription
D8LU88_ECTSI8.740e-6397.17Ubiquitin domain-containing protein (Partial) (Fra... [more]
A0A6H5KTV6_9PHAE3.020e-6296.23USP domain-containing protein n=1 Tax=Ectocarpus s... [more]
A0A835YQG3_9STRA9.060e-4273.40USP domain-containing protein n=1 Tax=Tribonema mi... [more]
A0A7S4ITW2_9EUKA4.770e-3457.55Ubiquitin carboxyl-terminal hydrolase (Fragment) n... [more]
UPI000644FF273.320e-3251.20hypothetical protein n=1 Tax=Acytostelium subglobo... [more]
A0A0D2WMI0_CAPO33.510e-3056.19Ubiquitinyl hydrolase 1 n=1 Tax=Capsaspora owczarz... [more]
A0A6B2KX30_9EUKA4.540e-3050.96USP domain-containing protein n=2 Tax=Arcella inte... [more]
L8GPA8_ACACA8.850e-3054.72Ubiquitinyl hydrolase 1 n=1 Tax=Acanthamoeba caste... [more]
A0A4D9CWN0_9STRA1.170e-2954.37USP domain-containing protein n=1 Tax=Nannochlorop... [more]
A0A1Y2GGR1_9FUNG1.650e-2952.73Ubiquitinyl hydrolase 1 n=1 Tax=Lobosporangium tra... [more]

Pages

back to top