|
|
Homology
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro7m male
Date Performed: 2022-09-29
| IPR Term | IPR Description | Source | Source Term | Source Description | Alignment |
| IPR002110 | Ankyrin repeat | PRINTS | PR01415 | ANKYRIN | coord: 165..179 score: 35.79 coord: 117..132 score: 34.48 |
| IPR002110 | Ankyrin repeat | SMART | SM00248 | ANK_2a | coord: 16..45 e-value: 14.0 score: 14.6 coord: 149..178 e-value: 8.2E-4 score: 28.7 coord: 116..145 e-value: 7.8E-4 score: 28.7 coord: 182..211 e-value: 0.013 score: 24.7 coord: 50..79 e-value: 0.0082 score: 25.4 coord: 215..244 e-value: 5.7E-6 score: 35.8 coord: 83..112 e-value: 0.0017 score: 27.7 |
| IPR002110 | Ankyrin repeat | PFAM | PF12796 | Ank_2 | coord: 2..79 e-value: 2.1E-12 score: 47.5 coord: 83..147 e-value: 1.1E-11 score: 45.1 coord: 155..246 e-value: 2.4E-17 score: 63.3 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 83..115 score: 12.39561 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 215..247 score: 14.10505 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 149..181 score: 12.9031 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 116..148 score: 14.45228 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 16..49 score: 10.79301 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 50..82 score: 11.51418 |
| IPR002110 | Ankyrin repeat | PROSITE | PS50088 | ANK_REPEAT | coord: 182..214 score: 9.75132 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 125..248 e-value: 1.4E-44 score: 154.1 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | GENE3D | 1.25.40.20 | | coord: 1..124 e-value: 8.6E-36 score: 125.2 |
| IPR036770 | Ankyrin repeat-containing domain superfamily | SUPERFAMILY | 48403 | Ankyrin repeat | coord: 2..246 |
| None | No IPR available | PANTHER | PTHR24180 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C-RELATED | coord: 182..247 coord: 69..168 |
| None | No IPR available | PANTHER | PTHR24180:SF15 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C | coord: 69..168 |
| None | No IPR available | PANTHER | PTHR24180 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C-RELATED | coord: 118..209 |
| None | No IPR available | PANTHER | PTHR24180:SF15 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C | coord: 118..209 |
| None | No IPR available | PANTHER | PTHR24180:SF15 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C | coord: 37..111 coord: 182..247 |
| None | No IPR available | PANTHER | PTHR24180:SF15 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C | coord: 2..78 |
| None | No IPR available | PANTHER | PTHR24180 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C-RELATED | coord: 37..111 |
| None | No IPR available | PANTHER | PTHR24180 | CYCLIN-DEPENDENT KINASE INHIBITOR 2C-RELATED | coord: 2..78 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 83..111 score: 11.214048 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 50..82 score: 10.152792 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 215..247 score: 12.726336 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 182..208 score: 8.852755 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 116..148 score: 13.071245 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 149..180 score: 11.532425 |
| None | No IPR available | PROSITE | PS50297 | ANK_REP_REGION | coord: 16..49 score: 9.356852 |
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_M_contigs8006.1.1 ID=prot_H-canaliculatus_M_contigs8006.1.1|Name=mRNA_H-canaliculatus_M_contigs8006.1.1|organism=Hapterophycus canaliculatus Oshoro7m male|type=polypeptide|length=249bp RLLLERGAPADERDTQEWTPLHVACHSGRTDTVSRFLLTAGSTASARTDK NLTALHIACESGFTDTARLLLETGLSVSAVDDEAYSALHLASAGGHTDVV RLLLQAGAGPDSSTERNHRPLHLAAQYGHSSVVHLLLEAGATVDVRDDGN YTPTHLACTYGHTETTRILLQYGADVEALDSEEWSPFHWACQLGNVYTAR LLMSRGADRAARTSRGHQALHLAAENGHTETVRMLLDNQADPNAKDEVI back to top
Annotated Terms
The following terms have been associated with this polypeptide:
|