prot_H-canaliculatus_F_contig1099.906.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1099.906.1 vs. uniprot
Match: D7FMM2_ECTSI (GE20757 n=2 Tax=Ectocarpus TaxID=2879 RepID=D7FMM2_ECTSI) HSP 1 Score: 67.0 bits (162), Expect = 1.710e-11 Identity = 30/40 (75.00%), Postives = 34/40 (85.00%), Query Frame = 0 Query: 1 MGVWWAILGVALPTLRGRAKIAFGLASPLFITSLILYVSG 40 MGVWWAILGVALP LRG ++A G ASP FIT+LI+YVSG Sbjct: 235 MGVWWAILGVALPALRGPGRVALGFASPAFITALIMYVSG 274
BLAST of mRNA_H-canaliculatus_F_contig1099.906.1 vs. uniprot
Match: A0A6S9K4Z3_HETAK (Hypothetical protein n=1 Tax=Heterosigma akashiwo TaxID=2829 RepID=A0A6S9K4Z3_HETAK) HSP 1 Score: 51.6 bits (122), Expect = 5.950e-6 Identity = 23/38 (60.53%), Postives = 28/38 (73.68%), Query Frame = 0 Query: 3 VWWAILGVALPTLRGRAKIAFGLASPLFITSLILYVSG 40 VWW +LG+A P LRG ++A GLASPLF T L+ VSG Sbjct: 228 VWWGLLGLAAPLLRGPGQLALGLASPLFTTLLLTQVSG 265 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1099.906.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0 of Hapterophycus canaliculatus Oshoro5f female
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig1099.906.1 ID=prot_H-canaliculatus_F_contig1099.906.1|Name=mRNA_H-canaliculatus_F_contig1099.906.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=68bpback to top |