prot_H-canaliculatus_F_contig1073.699.1 (polypeptide) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig1073.699.1 vs. uniprot
Match: A0A6H5L5I7_9PHAE (Lipid_desat domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L5I7_9PHAE) HSP 1 Score: 70.5 bits (171), Expect = 7.550e-12 Identity = 32/39 (82.05%), Postives = 37/39 (94.87%), Query Frame = 0 Query: 73 EEVLVDDKGRPYNLGPEGFVRDLNTRAVRIARRVVEKSQ 111 EEVL+D+KGRPYNLGP GFVRDLNTRAV+IARRV ++SQ Sbjct: 44 EEVLIDNKGRPYNLGPRGFVRDLNTRAVKIARRVAQQSQ 82 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig1073.699.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-canaliculatus_F_contig1073.699.1 ID=prot_H-canaliculatus_F_contig1073.699.1|Name=mRNA_H-canaliculatus_F_contig1073.699.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=117bpback to top |