mRNA_H-canaliculatus_F_contig11071.976.1 (mRNA) Hapterophycus canaliculatus Oshoro5f female
Overview
Homology
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A0A0RTZ6_SACJA (Phosphomannomutase n=2 Tax=Phaeophyceae TaxID=2870 RepID=A0A0A0RTZ6_SACJA) HSP 1 Score: 69.3 bits (168), Expect = 3.520e-11 Identity = 30/36 (83.33%), Postives = 34/36 (94.44%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELFFKE 491 +GGND EIFESERTIGHTVTSP DT++QCKELFFK+ Sbjct: 217 KGGNDNEIFESERTIGHTVTSPADTIQQCKELFFKD 252
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A1J7HW20_LUPAN (Phosphomannomutase n=6 Tax=Lupinus TaxID=3869 RepID=A0A1J7HW20_LUPAN) HSP 1 Score: 66.2 bits (160), Expect = 5.030e-11 Identity = 28/33 (84.85%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELF 482 +GGND+EI+ESERTIGHTVTSPEDT+KQCK LF Sbjct: 86 KGGNDHEIYESERTIGHTVTSPEDTIKQCKALF 118
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A8B8L6F6_ABRPR (Phosphomannomutase n=3 Tax=Fabaceae TaxID=3803 RepID=A0A8B8L6F6_ABRPR) HSP 1 Score: 68.2 bits (165), Expect = 8.850e-11 Identity = 29/33 (87.88%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELF 482 +GGND+EI+ESERTIGHTVTSPEDTMKQCK LF Sbjct: 212 KGGNDHEIYESERTIGHTVTSPEDTMKQCKSLF 244
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: PMM_SPIOL (Phosphomannomutase n=3 Tax=Chenopodioideae TaxID=1307796 RepID=PMM_SPIOL) HSP 1 Score: 67.8 bits (164), Expect = 1.240e-10 Identity = 28/33 (84.85%), Postives = 31/33 (93.94%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELF 482 +GGNDYEIF SERT+GHTVTSPEDTMKQC E+F Sbjct: 211 EGGNDYEIFASERTVGHTVTSPEDTMKQCTEIF 243
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: L1IZJ7_GUITC (Phosphomannomutase n=3 Tax=Geminigeraceae TaxID=589343 RepID=L1IZJ7_GUITC) HSP 1 Score: 67.8 bits (164), Expect = 1.270e-10 Identity = 28/35 (80.00%), Postives = 32/35 (91.43%), Query Frame = 3 Query: 387 GGNDYEIFESERTIGHTVTSPEDTMKQCKELFFKE 491 GGNDYEIFE RTIGHTVTSPE+TM+ C+ELFFK+ Sbjct: 216 GGNDYEIFEDSRTIGHTVTSPEETMRLCRELFFKD 250
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A0J8B6D7_BETVV (Phosphomannomutase n=6 Tax=Beta vulgaris subsp. vulgaris TaxID=3555 RepID=A0A0J8B6D7_BETVV) HSP 1 Score: 67.4 bits (163), Expect = 1.660e-10 Identity = 28/36 (77.78%), Postives = 32/36 (88.89%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELFFKE 491 +GGNDYEIF SE+TIGHTVTSPEDTMKQC E+F + Sbjct: 208 EGGNDYEIFASEKTIGHTVTSPEDTMKQCTEIFLNK 243
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A6P4CLR7_ARADU (Phosphomannomutase n=9 Tax=Pentapetalae TaxID=1437201 RepID=A0A6P4CLR7_ARADU) HSP 1 Score: 67.4 bits (163), Expect = 1.700e-10 Identity = 29/35 (82.86%), Postives = 32/35 (91.43%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELFFK 488 +GGND+EI+ESERTIGHTVTSPEDTMKQC LF K Sbjct: 212 KGGNDHEIYESERTIGHTVTSPEDTMKQCTALFLK 246
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A5B6UVU3_9ROSI (Phosphomannomutase n=1 Tax=Gossypium australe TaxID=47621 RepID=A0A5B6UVU3_9ROSI) HSP 1 Score: 64.7 bits (156), Expect = 2.300e-10 Identity = 26/33 (78.79%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELF 482 +GGND+EI+ESERT+GHTVTSP+DT+KQCK LF Sbjct: 92 KGGNDHEIYESERTVGHTVTSPDDTVKQCKALF 124
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A0A2P6SGY2_ROSCH (Phosphomannomutase n=3 Tax=Rosoideae TaxID=171638 RepID=A0A2P6SGY2_ROSCH) HSP 1 Score: 67.0 bits (162), Expect = 2.360e-10 Identity = 27/34 (79.41%), Postives = 33/34 (97.06%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELFF 485 +GGND+EI+ESERT+GHTVTSPEDT++QCK LFF Sbjct: 212 EGGNDHEIYESERTVGHTVTSPEDTVEQCKALFF 245
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Match: A9SYE1_PHYPA (Phosphomannomutase n=1 Tax=Physcomitrium patens TaxID=3218 RepID=A9SYE1_PHYPA) HSP 1 Score: 67.0 bits (162), Expect = 2.460e-10 Identity = 28/33 (84.85%), Postives = 32/33 (96.97%), Query Frame = 3 Query: 384 QGGNDYEIFESERTIGHTVTSPEDTMKQCKELF 482 QGGND+EIFESE+TIGHTVTSPEDT++QC ELF Sbjct: 212 QGGNDHEIFESEKTIGHTVTSPEDTIRQCSELF 244 The following BLAST results are available for this feature:
BLAST of mRNA_H-canaliculatus_F_contig11071.976.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 of Hapterophycus canaliculatus Oshoro5f female vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-canaliculatus_F_contig11071.976.1 >prot_H-canaliculatus_F_contig11071.976.1 ID=prot_H-canaliculatus_F_contig11071.976.1|Name=mRNA_H-canaliculatus_F_contig11071.976.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=polypeptide|length=48bp MDRSNVWSLRTQGGNDYEIFESERTIGHTVTSPEDTMKQCKELFFKE*back to top mRNA from alignment at H-canaliculatus_F_contig11071:104..597+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-canaliculatus_F_contig11071.976.1 ID=mRNA_H-canaliculatus_F_contig11071.976.1|Name=mRNA_H-canaliculatus_F_contig11071.976.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=mRNA|length=494bp|location=Sequence derived from alignment at H-canaliculatus_F_contig11071:104..597+ (Hapterophycus canaliculatus Oshoro5f female)back to top Coding sequence (CDS) from alignment at H-canaliculatus_F_contig11071:104..597+ >mRNA_H-canaliculatus_F_contig11071.976.1 ID=mRNA_H-canaliculatus_F_contig11071.976.1|Name=mRNA_H-canaliculatus_F_contig11071.976.1|organism=Hapterophycus canaliculatus Oshoro5f female|type=CDS|length=288bp|location=Sequence derived from alignment at H-canaliculatus_F_contig11071:104..597+ (Hapterophycus canaliculatus Oshoro5f female)back to top |