mRNA_H-paniculata_contig14782.2854.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14782.2854.1 vs. uniprot
Match: A0A6H5L7P6_9PHAE (Rhodanese domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L7P6_9PHAE) HSP 1 Score: 85.1 bits (209), Expect = 2.060e-17 Identity = 42/69 (60.87%), Postives = 54/69 (78.26%), Query Frame = 1 Query: 43 KTTEFQCFLGRQREGRANEHVVLDLRPIADFQREHLVGATSIPAVELEARMLELPPPFGCPVSVVGSDE 249 K +EFQ ++GR++ G + VVLDLRP ADF+REHL G+TSIP ELE R+LELPPPF PV++VGS + Sbjct: 113 KPSEFQEYVGRRKSG--SRRVVLDLRPRADFRREHLEGSTSIPIDELEPRLLELPPPFAQPVNIVGSQQ 179
BLAST of mRNA_H-paniculata_contig14782.2854.1 vs. uniprot
Match: D7FQG6_ECTSI (Tellurite resistance methyltransferase, TehB, core n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7FQG6_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 2.070e-17 Identity = 42/67 (62.69%), Postives = 53/67 (79.10%), Query Frame = 1 Query: 49 TEFQCFLGRQREGRANEHVVLDLRPIADFQREHLVGATSIPAVELEARMLELPPPFGCPVSVVGSDE 249 +EFQ F+GR++ G + VVLDLRP ADF+REHL G+TSIP ELE R+LELPPPF PV++VGS + Sbjct: 116 SEFQEFVGRRKSG--SRRVVLDLRPRADFRREHLEGSTSIPVDELEPRLLELPPPFAQPVNIVGSQQ 180
BLAST of mRNA_H-paniculata_contig14782.2854.1 vs. uniprot
Match: A0A7S2ZAJ0_9RHOD (Hypothetical protein (Fragment) n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S2ZAJ0_9RHOD) HSP 1 Score: 48.9 bits (115), Expect = 3.900e-5 Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 106 VLDLRPIADFQREHLVGATSIPAVELEARMLELPPPFGCPVSVVGSDE 249 ++D+R F R HL +TSIPA EL+ R+LE+PPP P++++G E Sbjct: 73 IIDIRTKESFARGHLPCSTSIPADELQERLLEMPPPVEDPLTLLGESE 120
BLAST of mRNA_H-paniculata_contig14782.2854.1 vs. uniprot
Match: A0A7S3E5W8_9RHOD (Hypothetical protein n=1 Tax=Rhodosorus marinus TaxID=101924 RepID=A0A7S3E5W8_9RHOD) HSP 1 Score: 48.9 bits (115), Expect = 8.430e-5 Identity = 22/48 (45.83%), Postives = 33/48 (68.75%), Query Frame = 1 Query: 106 VLDLRPIADFQREHLVGATSIPAVELEARMLELPPPFGCPVSVVGSDE 249 ++D+R F R HL +TSIPA EL+ R+LE+PPP P++++G E Sbjct: 73 IIDIRTKESFARGHLPCSTSIPADELQERLLEMPPPVEDPLTLLGESE 120 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14782.2854.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 4
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14782.2854.1 >prot_H-paniculata_contig14782.2854.1 ID=prot_H-paniculata_contig14782.2854.1|Name=mRNA_H-paniculata_contig14782.2854.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=88bp SSGSLPPTPRKTRTKTTEFQCFLGRQREGRANEHVVLDLRPIADFQREHLback to top mRNA from alignment at H-paniculata_contig14782:220..483- Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14782.2854.1 ID=mRNA_H-paniculata_contig14782.2854.1|Name=mRNA_H-paniculata_contig14782.2854.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=264bp|location=Sequence derived from alignment at H-paniculata_contig14782:220..483- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14782:220..483- >mRNA_H-paniculata_contig14782.2854.1 ID=mRNA_H-paniculata_contig14782.2854.1|Name=mRNA_H-paniculata_contig14782.2854.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=528bp|location=Sequence derived from alignment at H-paniculata_contig14782:220..483- (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |