prot_H-paniculata_contig14642.2778.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14642.2778.1 vs. uniprot
Match: A0A6H5JRB6_9PHAE (RanBP2-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JRB6_9PHAE) HSP 1 Score: 61.2 bits (147), Expect = 2.060e-6 Identity = 31/51 (60.78%), Postives = 38/51 (74.51%), Query Frame = 0 Query: 204 DPGILYLNPATSETTRVPPPELLAQSEEADEAGGYLIFVPSSVFVAAAVGA 254 D G +YLN AT ET R PP EL+A +++A+ AG YL+FVPS FVAAA GA Sbjct: 437 DQGPVYLNTATMETVREPPAELVALADQAESAGDYLVFVPSHRFVAAAAGA 487 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14642.2778.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 1
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14642.2778.1 ID=prot_H-paniculata_contig14642.2778.1|Name=mRNA_H-paniculata_contig14642.2778.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=399bpback to top |