prot_H-paniculata_contig14509.2703.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Match: A0A6G0WP62_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WP62_9STRA) HSP 1 Score: 52.8 bits (125), Expect = 9.170e-6 Identity = 30/87 (34.48%), Postives = 51/87 (58.62%), Query Frame = 0 Query: 1 MRPYADASLIVGKDIQAVFAAAQQQGEFQISHILDIGESPDKKGEYVVLVEWVGLGAEESSWEPLAVIHEDVPQYLRRKLKKMRLDA 87 ++ YA++ L V D+ A + F + +L + + D G + +LV+W+GL EESSWEP ++ED+P LRR++K + +A Sbjct: 1204 LKMYAESGLEVTDDLVQHIAYGDEG--FYVEDLLKVRCNDD--GNFELLVKWMGLDREESSWEPAIQLYEDIPVILRRRIKSHQSEA 1286
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Match: A0A024TQN1_9STRA (Chromo domain-containing protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TQN1_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 9.090e-5 Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 0 Query: 26 GEFQISHILDIGESPDKKGEYVVLVEWVGLGAEESSWEPLAVIHEDVPQYLRR 78 G F + + ++ + + G Y VLV+W+GL AEESSWEP A + ED+P LR+ Sbjct: 43 GGFHVERLEEVRVAAN--GRYEVLVKWLGLDAEESSWEPAANLLEDIPVALRK 93 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 2
InterPro
Analysis Name: InterProScan on OGS1.0
Date Performed: 2022-09-29
Alignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14509.2703.1 ID=prot_H-paniculata_contig14509.2703.1|Name=mRNA_H-paniculata_contig14509.2703.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=102bpback to top |