mRNA_H-paniculata_contig14509.2703.1 (mRNA) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Match: A0A6G0WP62_9STRA (Uncharacterized protein n=1 Tax=Aphanomyces euteiches TaxID=100861 RepID=A0A6G0WP62_9STRA) HSP 1 Score: 54.7 bits (130), Expect = 2.000e-6 Identity = 31/88 (35.23%), Postives = 52/88 (59.09%), Query Frame = 1 Query: 1 RMRPYADASLIVGKDIQAVFAAAQQQGEFQISHILDIGESPDKKGEYVVLVEWVGLGAEESSWEPLAVIHEDVPQYLRRKLKKMRLDA 264 R++ YA++ L V D+ A + F + +L + + D G + +LV+W+GL EESSWEP ++ED+P LRR++K + +A Sbjct: 1203 RLKMYAESGLEVTDDLVQHIAYGDEG--FYVEDLLKVRCNDD--GNFELLVKWMGLDREESSWEPAIQLYEDIPVILRRRIKSHQSEA 1286
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Match: A0A024TQN1_9STRA (Chromo domain-containing protein n=1 Tax=Aphanomyces invadans TaxID=157072 RepID=A0A024TQN1_9STRA) HSP 1 Score: 48.5 bits (114), Expect = 9.370e-5 Identity = 24/53 (45.28%), Postives = 35/53 (66.04%), Query Frame = 1 Query: 79 GEFQISHILDIGESPDKKGEYVVLVEWVGLGAEESSWEPLAVIHEDVPQYLRR 237 G F + + ++ + + G Y VLV+W+GL AEESSWEP A + ED+P LR+ Sbjct: 43 GGFHVERLEEVRVAAN--GRYEVLVKWLGLDAEESSWEPAANLLEDIPVALRK 93 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14509.2703.1 vs. uniprot
Analysis Date: 2022-09-19 (Diamond blastx: OGS1.0 vs UniRef90) Total hits: 2
Alignments
The following features are aligned
Analyses
This mRNA is derived from or has results from the following analyses
Properties
Relationships
The following UTR feature(s) are a part of this mRNA:
The following CDS feature(s) are a part of this mRNA:
The following polypeptide feature(s) derives from this mRNA:
Sequences
The following sequences are available for this feature:
protein sequence of mRNA_H-paniculata_contig14509.2703.1 >prot_H-paniculata_contig14509.2703.1 ID=prot_H-paniculata_contig14509.2703.1|Name=mRNA_H-paniculata_contig14509.2703.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=102bp MRPYADASLIVGKDIQAVFAAAQQQGEFQISHILDIGESPDKKGEYVVLVback to top mRNA from alignment at H-paniculata_contig14509:448..756+ Legend: UTRpolypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.>mRNA_H-paniculata_contig14509.2703.1 ID=mRNA_H-paniculata_contig14509.2703.1|Name=mRNA_H-paniculata_contig14509.2703.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=mRNA|length=309bp|location=Sequence derived from alignment at H-paniculata_contig14509:448..756+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top Coding sequence (CDS) from alignment at H-paniculata_contig14509:448..756+ >mRNA_H-paniculata_contig14509.2703.1 ID=mRNA_H-paniculata_contig14509.2703.1|Name=mRNA_H-paniculata_contig14509.2703.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=CDS|length=612bp|location=Sequence derived from alignment at H-paniculata_contig14509:448..756+ (Halopteris paniculata Hal_grac_a_UBK monoicous)back to top |