prot_H-paniculata_contig14368.2626.1 (polypeptide) Halopteris paniculata Hal_grac_a_UBK monoicous
Overview
Homology
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: D7G6Q1_ECTSI (CCHC-type domain-containing protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G6Q1_ECTSI) HSP 1 Score: 85.1 bits (209), Expect = 8.230e-19 Identity = 37/44 (84.09%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 ME+L NT MEPGQNPDDYFN KHLLRHKV+KMGE ISDRYFKD+ Sbjct: 1 MEKLDNTSMEPGQNPDDYFNHKHLLRHKVEKMGEKISDRYFKDM 44
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5KW66_9PHAE (CCHC-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KW66_9PHAE) HSP 1 Score: 86.3 bits (212), Expect = 1.440e-18 Identity = 37/43 (86.05%), Postives = 39/43 (90.70%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKD 43 MEEL+NTPMEP QNPDDYFNQKHLLRHK +KMGETISD YF D Sbjct: 116 MEELINTPMEPRQNPDDYFNQKHLLRHKAEKMGETISDCYFND 158
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5L2I7_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5L2I7_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.490e-16 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE ISDR FKDI Sbjct: 95 MEELENNPMNPGENPDDYFNQKHLLRTQLDKMGEPISDRRFKDI 138
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5KDC9_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KDC9_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 1.850e-16 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE ISDR FKDI Sbjct: 95 MEELENNPMNPGENPDDYFNQKHLLRTQLDKMGEPISDRRFKDI 138
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: D7G2T3_ECTSI (Uncharacterized protein n=1 Tax=Ectocarpus siliculosus TaxID=2880 RepID=D7G2T3_ECTSI) HSP 1 Score: 77.0 bits (188), Expect = 1.930e-16 Identity = 33/44 (75.00%), Postives = 38/44 (86.36%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL+NTPME GQ PD YFNQKHLLRHK ++MG+TI DR F+DI Sbjct: 99 MEELINTPMETGQTPDVYFNQKHLLRHKAEEMGKTILDRSFRDI 142
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5JLQ5_9PHAE (CCHC-type domain-containing protein (Fragment) n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JLQ5_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 2.000e-16 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE ISDR FKDI Sbjct: 71 MEELENNPMNPGENPDDYFNQKHLLRTQLDKMGEPISDRRFKDI 114
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5KY05_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KY05_9PHAE) HSP 1 Score: 77.0 bits (188), Expect = 2.060e-16 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE ISDR FKDI Sbjct: 93 MEELENNPMNPGENPDDYFNQKHLLRTQLDKMGEHISDRRFKDI 136
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5JV98_9PHAE (Peptidase A2 domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JV98_9PHAE) HSP 1 Score: 80.1 bits (196), Expect = 2.110e-16 Identity = 33/44 (75.00%), Postives = 40/44 (90.91%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL+N PMEPGQNPD YFNQ+HL+R+K +K+GETIS RYFKD+ Sbjct: 118 MEELINAPMEPGQNPDVYFNQRHLVRYKAEKLGETISYRYFKDM 161
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5KZM5_9PHAE (CCHC-type domain-containing protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5KZM5_9PHAE) HSP 1 Score: 77.4 bits (189), Expect = 9.790e-16 Identity = 34/44 (77.27%), Postives = 37/44 (84.09%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE ISDR FKDI Sbjct: 1 MEELENNPMNPGENPDDYFNQKHLLRTQLDKMGEPISDRRFKDI 44
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Match: A0A6H5JT96_9PHAE (Uncharacterized protein n=1 Tax=Ectocarpus sp. CCAP 1310/34 TaxID=867726 RepID=A0A6H5JT96_9PHAE) HSP 1 Score: 74.7 bits (182), Expect = 1.000e-15 Identity = 33/44 (75.00%), Postives = 36/44 (81.82%), Query Frame = 0 Query: 1 MEELVNTPMEPGQNPDDYFNQKHLLRHKVQKMGETISDRYFKDI 44 MEEL N PM PG+NPDDYFNQKHLLR ++ KMGE IS R FKDI Sbjct: 94 MEELENNPMNPGENPDDYFNQKHLLRAQLDKMGEPISGRRFKDI 137 The following BLAST results are available for this feature:
BLAST of mRNA_H-paniculata_contig14368.2626.1 vs. uniprot
Analysis Date: 2022-09-16 (Diamond blastp: OGS1.0 vs UniRef90) Total hits: 25
Pagesback to topAlignments
The following features are aligned
Analyses
This polypeptide is derived from or has results from the following analyses
Relationships
This polypeptide derives from the following mRNA feature(s):
Sequences
The following sequences are available for this feature:
polypeptide sequence >prot_H-paniculata_contig14368.2626.1 ID=prot_H-paniculata_contig14368.2626.1|Name=mRNA_H-paniculata_contig14368.2626.1|organism=Halopteris paniculata Hal_grac_a_UBK monoicous|type=polypeptide|length=45bpback to top |